EpCAM/TROP1 Antibody

Images

 
Western Blot: EpCAM/TROP1 Antibody [H00004072-D01P] - Analysis of EPCAM expression in human pancreas.
Western Blot: EpCAM/TROP1 Antibody [H00004072-D01P] - Analysis of EPCAM expression in A-431.
Western Blot: EpCAM/TROP1 Antibody [H00004072-D01P] - Analysis of EPCAM expression in transfected 293T cell line by EPCAM polyclonal antibody.Lane 1: EPCAM transfected lysate(34.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related EpCAM/TROP1 Primary Antibodies

Order Details


    • Catalog Number
      H00004072-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EpCAM/TROP1 Antibody Summary

Immunogen
EPCAM (NP_002345.1, 1 a.a. - 314 a.a.) full-length human protein. MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Specificity
TACSTD1 - tumor-associated calcium signal transducer 1,
Clonality
Polyclonal
Host
Rabbit
Gene
EPCAM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004072-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EpCAM/TROP1 Antibody

  • 17-1A
  • 323/A3
  • ACSTD1
  • antigen identified by monoclonal AUA1
  • CD326 antigen
  • CD326
  • Cell surface glycoprotein Trop-1
  • chromosome 4, surface marker (35kD glycoprotein)
  • DIAR5
  • EGP
  • EGP-2
  • EGP314
  • EGP40
  • EpCAM
  • epithelial cell adhesion molecule
  • Epithelial cell surface antigen
  • Epithelial glycoprotein 314
  • Epithelial glycoprotein
  • ESA
  • GA733-2
  • GA733-2EGP34
  • gp40
  • hEGP314
  • HNPCC8
  • KS 1/4 antigen
  • KS1/4
  • KSAHEA125
  • M1S2
  • M4S1
  • M4S1Ly74
  • Major gastrointestinal tumor-associated protein GA733-2
  • MIC18MH99
  • MOC31
  • TACST-1
  • TACSTD1
  • TROP1
  • TROP1CD326
  • Tumor-associated calcium signal transducer 1CO-17A

Background

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5248
Species: Hu
Applications: IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready

Publications for EpCAM/CD326 Antibody (H00004072-D01P)(1)

Reviews for EpCAM/CD326 Antibody (H00004072-D01P) (0)

There are no reviews for EpCAM/CD326 Antibody (H00004072-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EpCAM/CD326 Antibody (H00004072-D01P). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for EpCAM antibody for rat. Do you have any antibody which can use FACS?
    • We unfortunately do not have any EpCAM antibodies validated in FACS for detection of the rat protein. I am sorry for any inconvenience. I do have three products to EpCAM that can detect the rat protein. These products have been validated to detect the native rat protein, so they may work for FACS however they have not yet been tested in that particular application. If you would like to try them in your experiment you would qualify for our Innovator's Reward Program. This program was designed to help scientists with the cost of their antibodies in return for valuable information. If you decide to test an antibody in a previously untested species or application we will issue you a credit for the purchase price of the antibody in exchange for a review of your experiment using our product.

Secondary Antibodies

 

Isotype Controls

Additional EpCAM/TROP1 Products

Bioinformatics Tool for EpCAM/CD326 Antibody (H00004072-D01P)

Discover related pathways, diseases and genes to EpCAM/CD326 Antibody (H00004072-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EpCAM/CD326 Antibody (H00004072-D01P)

Discover more about diseases related to EpCAM/CD326 Antibody (H00004072-D01P).
 

Pathways for EpCAM/CD326 Antibody (H00004072-D01P)

View related products by pathway.

PTMs for EpCAM/CD326 Antibody (H00004072-D01P)

Learn more about PTMs related to EpCAM/CD326 Antibody (H00004072-D01P).
 

Research Areas for EpCAM/CD326 Antibody (H00004072-D01P)

Find related products by research area.

Blogs on EpCAM/TROP1

There are no specific blogs for EpCAM/TROP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EpCAM/TROP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPCAM
Entrez
Uniprot