EPB41 Antibody (3D9) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related EPB41 Primary Antibodies

Order Details


    • Catalog Number
      H00002035-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EPB41 Antibody (3D9) [DyLight 405] Summary

Immunogen
EPB41 (AAH39079 116 a.a. - 225 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV
Specificity
EPB41 - erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPB41
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against transfected lysate for Western Blot. Has also been used for immunohistochemistry (paraffin), immunofluorescence, and ELISA.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EPB41 Antibody (3D9) [DyLight 405]

  • 4.1RBand 4.1
  • E41P
  • EL1
  • EPB4.1
  • erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
  • erythrocyte surface protein band 4.1
  • HE
  • P4.1
  • protein 4.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31650
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90325
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-31370
Species: Hu, Mu
Applications: WB, ICC/IF
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB6638
Species: Hu, Mu, Rt
Applications: WB
H00002035-M01V
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for EPB41 Antibody (H00002035-M01V) (0)

There are no publications for EPB41 Antibody (H00002035-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41 Antibody (H00002035-M01V) (0)

There are no reviews for EPB41 Antibody (H00002035-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPB41 Antibody (H00002035-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPB41 Antibody (3D9) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for EPB41 Antibody (H00002035-M01V)

Discover related pathways, diseases and genes to EPB41 Antibody (H00002035-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB41 Antibody (H00002035-M01V)

Discover more about diseases related to EPB41 Antibody (H00002035-M01V).
 

Pathways for EPB41 Antibody (H00002035-M01V)

View related products by pathway.

PTMs for EPB41 Antibody (H00002035-M01V)

Learn more about PTMs related to EPB41 Antibody (H00002035-M01V).

Blogs on EPB41

There are no specific blogs for EPB41, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB41 Antibody (3D9) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41