EOMES Antibody

Images

 
Immunohistochemistry-Paraffin: EOMES Antibody [NBP1-80699] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: EOMES Antibody [NBP1-80699] - Staining of human lymph node tissues shows moderate nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EOMES Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTV
Specificity
Specificity of human EOMES antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EOMES
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-80699 in the following applications:

Publications
Read Publications using
NBP1-80699 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EOMES Antibody

  • EOMES
  • eomesodermin (Xenopus laevis) homolog
  • Eomesodermin
  • t box, brain, 2
  • T-box brain protein 2
  • T-box brain2
  • TBR2
  • TBR-2
  • TBR2eomesodermin homolog
  • T-brain-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-62728
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF
NB100-2136
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-80699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for EOMES Antibody (NBP1-80699)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-F.


Filter By Application
IHC-F
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for EOMES Antibody (NBP1-80699) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rhesus monkey.

Reviews using NBP1-80699:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Rhesus monkey
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin EOMES NBP1-80699
Enlarge
reviewed by:
Anonymous
IHC-P Rhesus monkey 06/14/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedAdult kidney
SpeciesRhesus monkey
LotA104960

Comments

CommentsParaffin sections after antigen retrieval pH9, and permeabilization with triton 0.3%. AF488 was used as secondary.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EOMES Antibody (NBP1-80699). (Showing 1 - 1 of 1 FAQs).

  1. Please supply a list of eomes antibodies
    • Here is a link to all of our EOMES antibodies

Secondary Antibodies

 

Isotype Controls

Additional EOMES Products

Bioinformatics Tool for EOMES Antibody (NBP1-80699)

Discover related pathways, diseases and genes to EOMES Antibody (NBP1-80699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EOMES Antibody (NBP1-80699)

Discover more about diseases related to EOMES Antibody (NBP1-80699).
 

Pathways for EOMES Antibody (NBP1-80699)

View related products by pathway.

PTMs for EOMES Antibody (NBP1-80699)

Learn more about PTMs related to EOMES Antibody (NBP1-80699).
 

Research Areas for EOMES Antibody (NBP1-80699)

Find related products by research area.

Blogs on EOMES

There are no specific blogs for EOMES, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
06/14/2017
Application: IHC-P
Species: Rhesus monkey

Bioinformatics

Gene Symbol EOMES
Entrez
Uniprot