ENT1 Antibody


Western Blot: ENT1 Antibody [NBP1-84839] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: ENT1 Antibody [NBP1-84839] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: ENT1 Antibody [NBP1-84839] - Staining of human hippocampus shows strong nuclear positivity in glial cells).

Product Details

Product Discontinued
View other related ENT1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ENT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:TQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPLPERNSL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
ENT1 Lysate (NBP2-66015)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ENT1 Antibody

  • ENT1es-type
  • equilibrative nucleoside transporter 1
  • MGC1465
  • MGC3778
  • solute carrier family 29 (nucleoside transporters), member 1
  • Solute carrier family 29 member 1
  • solute carrier family 29, member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ENT1 Antibody (NBP1-84839) (0)

There are no publications for ENT1 Antibody (NBP1-84839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENT1 Antibody (NBP1-84839) (0)

There are no reviews for ENT1 Antibody (NBP1-84839). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ENT1 Antibody (NBP1-84839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional ENT1 Products

Bioinformatics Tool for ENT1 Antibody (NBP1-84839)

Discover related pathways, diseases and genes to ENT1 Antibody (NBP1-84839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENT1 Antibody (NBP1-84839)

Discover more about diseases related to ENT1 Antibody (NBP1-84839).

Pathways for ENT1 Antibody (NBP1-84839)

View related products by pathway.

PTMs for ENT1 Antibody (NBP1-84839)

Learn more about PTMs related to ENT1 Antibody (NBP1-84839).

Blogs on ENT1

There are no specific blogs for ENT1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ENT1 Antibody and receive a gift card or discount.


Gene Symbol SLC29A1