Recombinant Human Endothelin-3 Protein (H00001908-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Endothelin-3 Protein Summary

Description
Endothelin-3 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EDN3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Endothelin-3 Protein

  • EDN3
  • endothelin 3
  • Endothelin3
  • Endothelin-3
  • ET3
  • ET-3
  • HSCR4
  • MGC15067
  • MGC61498
  • PPET3
  • preproendothelin-3
  • truncated endothelin 3
  • WS4B

Background

EDN3( AAH08876, 1 a.a. - 239 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30599
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
AF1784
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2864
Species: Hu, Rt
Applications: IHC, ICC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001908-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Endothelin-3 Recombinant Protein (H00001908-P01) (0)

There are no publications for Endothelin-3 Recombinant Protein (H00001908-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endothelin-3 Recombinant Protein (H00001908-P01) (0)

There are no reviews for Endothelin-3 Recombinant Protein (H00001908-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endothelin-3 Recombinant Protein (H00001908-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Endothelin-3 Protein Products

Related Products by Gene

Bioinformatics Tool for Endothelin-3 Recombinant Protein (H00001908-P01)

Discover related pathways, diseases and genes to Endothelin-3 Recombinant Protein (H00001908-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endothelin-3 Recombinant Protein (H00001908-P01)

Discover more about diseases related to Endothelin-3 Recombinant Protein (H00001908-P01).
 

Pathways for Endothelin-3 Recombinant Protein (H00001908-P01)

View related products by pathway.

PTMs for Endothelin-3 Recombinant Protein (H00001908-P01)

Learn more about PTMs related to Endothelin-3 Recombinant Protein (H00001908-P01).

Blogs on Endothelin-3

There are no specific blogs for Endothelin-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Endothelin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EDN3
Entrez

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605
iNOS Antibody
NB300-605
iNOS Antibody
NB300-605