Endoglin/CD105 Antibody


Western Blot: Endoglin/CD105 Antibody [NBP1-59143] - Titration: 2.0ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: Endoglin/CD105 Antibody [NBP1-59143] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Endoglin/CD105 Antibody Summary

Synthetic peptides corresponding to ENG (endoglin (Osler-Rendu-Weber syndrome 1)) The peptide sequence was selected from the N terminal of ENG. Peptide sequence ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ.
Neo-endothelial Cells Marker
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ENG and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-59143 in the following applications:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Endoglin/CD105 Antibody

  • CD105 antigen
  • CD105
  • Endoglin
  • ENDOsler-Rendu-Weber syndrome 1
  • ENG
  • HHT1FLJ41744
  • ORW
  • ORW1


Endoglin is a homodimeric transmembrane glycoprotein highly expressed by endothelial cells. It is a component of the transforming growth factor beta receptor complex since it binds TGFB1 and TGFB3 with high affinity. Mutations in the endoglin gene produce hereditary hemorrhagic telangiectasia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
Species: Hu
Applications: WB, ChIP, ELISA
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Endoglin/CD105 Antibody (NBP1-59143)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Endoglin/CD105 Antibody (NBP1-59143) (0)

There are no reviews for Endoglin/CD105 Antibody (NBP1-59143). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endoglin/CD105 Antibody (NBP1-59143). (Showing 1 - 3 of 3 FAQ).

  1. I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?
    • We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.
  2. We are interested in CD105 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD105 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD105 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.
  3. Please confirm that NBP1-59143 will work on Rat tissue by IHC(P).
    • Rat is a predicted reactive species for this antibody; sharing 91% homology to the antibody's immunogen. For species that share 90% or higher homology, we offer our guarantee. Unfortunately, the predicted species are not visible on our PDF datasheets at this time.

Secondary Antibodies


Isotype Controls

Additional Endoglin/CD105 Products

Bioinformatics Tool for Endoglin/CD105 Antibody (NBP1-59143)

Discover related pathways, diseases and genes to Endoglin/CD105 Antibody (NBP1-59143). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endoglin/CD105 Antibody (NBP1-59143)

Discover more about diseases related to Endoglin/CD105 Antibody (NBP1-59143).

Pathways for Endoglin/CD105 Antibody (NBP1-59143)

View related products by pathway.

PTMs for Endoglin/CD105 Antibody (NBP1-59143)

Learn more about PTMs related to Endoglin/CD105 Antibody (NBP1-59143).

Research Areas for Endoglin/CD105 Antibody (NBP1-59143)

Find related products by research area.

Blogs on Endoglin/CD105

There are no specific blogs for Endoglin/CD105, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Endoglin/CD105 Antibody and receive a gift card or discount.


Gene Symbol ENG