Enah/Vasp-like Antibody (5G1) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Enah/Vasp-like Primary Antibodies

Order Details


    • Catalog Number
      H00051466-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Enah/Vasp-like Antibody (5G1) [DyLight 488] Summary

Immunogen
EVL (NP_057421, 309 a.a. ~ 419 a.a) partial recombinant protein with GST tag.PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAK SPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEE VVRELHKVKEEIIDAIRQELSGISTT
Localization
Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Note=Targeted to the leading edge of lamellipodia and the distal tip of stress fibers through interaction with a number of proteins. In activated T-cells, localizes to the F-actin collar and the dis
Specificity
EVL - Enah/Vasp-like
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EVL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Enah/Vasp-like Antibody (5G1) [DyLight 488]

  • ena/VASP-like protein
  • Enah/Vasp-like
  • RNB6Ena/vasodilator-stimulated phosphoprotein-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13378
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-56761
Species: Hu
Applications: WB
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Enah/Vasp-like Antibody (H00051466-M01G) (0)

There are no publications for Enah/Vasp-like Antibody (H00051466-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Enah/Vasp-like Antibody (H00051466-M01G) (0)

There are no reviews for Enah/Vasp-like Antibody (H00051466-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Enah/Vasp-like Antibody (H00051466-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Enah/Vasp-like Products

Bioinformatics Tool for Enah/Vasp-like Antibody (H00051466-M01G)

Discover related pathways, diseases and genes to Enah/Vasp-like Antibody (H00051466-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enah/Vasp-like Antibody (H00051466-M01G)

Discover more about diseases related to Enah/Vasp-like Antibody (H00051466-M01G).
 

Pathways for Enah/Vasp-like Antibody (H00051466-M01G)

View related products by pathway.

PTMs for Enah/Vasp-like Antibody (H00051466-M01G)

Learn more about PTMs related to Enah/Vasp-like Antibody (H00051466-M01G).
 

Research Areas for Enah/Vasp-like Antibody (H00051466-M01G)

Find related products by research area.

Blogs on Enah/Vasp-like

There are no specific blogs for Enah/Vasp-like, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enah/Vasp-like Antibody (5G1) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol EVL