EN-RAGE/S100A12 Recombinant Protein Antigen

Images

 
There are currently no images for EN-RAGE/S100A12 Protein (NBP1-86694PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EN-RAGE/S100A12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A12.

Source: E.coli

Amino Acid Sequence: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86694.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for EN-RAGE/S100A12 Recombinant Protein Antigen

  • CAAF1
  • CAAF1Neutrophil S100 protein
  • CAAFI
  • CAGC
  • CAGCS100 calcium binding protein A12 (calgranulin C)
  • CAGCS100
  • Calcium-binding protein in amniotic fluid 1
  • Calgranulin C
  • calgranulin-C
  • CGRPEN-RAGE
  • ENRAGE
  • EN-RAGE
  • Extracellular newly identified RAGE-binding protein
  • MRP6
  • p6calgranulin C
  • protein S100-A12
  • S100 calcium binding protein A12
  • S100 calcium-binding protein A12 (calgranulin C)
  • S100 calcium-binding protein A12
  • S100A12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Pm, Pm, Rb, Xp
Applications: IHC, IHC-P
NBP2-78736
Species: Hu
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-94078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-1617
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P

Publications for EN-RAGE/S100A12 Protein (NBP1-86694PEP) (0)

There are no publications for EN-RAGE/S100A12 Protein (NBP1-86694PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EN-RAGE/S100A12 Protein (NBP1-86694PEP) (0)

There are no reviews for EN-RAGE/S100A12 Protein (NBP1-86694PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EN-RAGE/S100A12 Protein (NBP1-86694PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EN-RAGE/S100A12 Products

Bioinformatics Tool for EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Discover related pathways, diseases and genes to EN-RAGE/S100A12 Protein (NBP1-86694PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Discover more about diseases related to EN-RAGE/S100A12 Protein (NBP1-86694PEP).
 

Pathways for EN-RAGE/S100A12 Protein (NBP1-86694PEP)

View related products by pathway.

PTMs for EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Learn more about PTMs related to EN-RAGE/S100A12 Protein (NBP1-86694PEP).
 

Research Areas for EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Find related products by research area.

Blogs on EN-RAGE/S100A12

There are no specific blogs for EN-RAGE/S100A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EN-RAGE/S100A12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A12