EMX2 Antibody (3H8)

Images

 

Product Details

Summary
Product Discontinued
View other related EMX2 Primary Antibodies

Order Details


    • Catalog Number
      H00002018-M07
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EMX2 Antibody (3H8) Summary

Immunogen
EMX2 (NP_004089, 103 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
Specificity
EMX2 - empty spiracles homolog 2 (Drosophila)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EMX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMX2 Antibody (3H8)

  • empty spiracles homeobox 2
  • empty spiracles homolog 2 (Drosophila)
  • Empty spiracles homolog 2
  • Empty spiracles-like protein 2
  • EMX2
  • homeobox protein EMX2

Background

The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 (MIM 600034) and EMX2 are related to the 'empty spiracles' gene expressed in the developing Drosophila head.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86500
Species: Hu
Applications: IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
423-F8/CF
Species: Hu, Mu
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29861
Species: Mu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002018-M07
Species: Hu
Applications: ELISA

Publications for EMX2 Antibody (H00002018-M07) (0)

There are no publications for EMX2 Antibody (H00002018-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMX2 Antibody (H00002018-M07) (0)

There are no reviews for EMX2 Antibody (H00002018-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EMX2 Antibody (H00002018-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EMX2 Products

Bioinformatics Tool for EMX2 Antibody (H00002018-M07)

Discover related pathways, diseases and genes to EMX2 Antibody (H00002018-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMX2 Antibody (H00002018-M07)

Discover more about diseases related to EMX2 Antibody (H00002018-M07).
 

Pathways for EMX2 Antibody (H00002018-M07)

View related products by pathway.

PTMs for EMX2 Antibody (H00002018-M07)

Learn more about PTMs related to EMX2 Antibody (H00002018-M07).

Blogs on EMX2

There are no specific blogs for EMX2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMX2 Antibody (3H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol EMX2
Entrez
OMIM
Uniprot