EMR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: EMR1 Antibody [NBP2-13960] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EMR1 Antibody - BSA Free (NBP2-13960) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EMR1 Recombinant Protein Antigen (NBP2-13960PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EMR1 Antibody - BSA Free

• ADGRE1
• egf-like module containing, mucin-like, hormone receptor-like 1
• egf-like module containing, mucin-like, hormone receptor-like sequence 1
• EGF-like module receptor 1
• EGF-like module-containing mucin-like hormone receptor-like 1
• EMR1 hormone receptor
• EMR1
• TM7LN3

Background

This gene encodes a protein that has a domain resembling seven transmembrane G protein-coupled hormone receptors (7TM receptors) at its C-terminus. The N-terminus of the encoded protein has six EGF-like modules, separated from the transmembrane segments by a serine/threonine-rich domain, a feature reminiscent of mucin-like, single-span, integral membrane glycoproteins with adhesive properties.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRE1