EMR1 Antibody


Immunohistochemistry-Paraffin: EMR1 Antibody [NBP2-13960] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

EMR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGG RWTSFGCVILEASETYTICSCNQMAN
Specificity of human EMR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EMR1 Recombinant Protein Antigen (NBP2-13960PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EMR1 Antibody

  • ADGRE1
  • egf-like module containing, mucin-like, hormone receptor-like 1
  • egf-like module containing, mucin-like, hormone receptor-like sequence 1
  • EGF-like module receptor 1
  • EGF-like module-containing mucin-like hormone receptor-like 1
  • EMR1 hormone receptor
  • EMR1
  • TM7LN3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Pm
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ELISA, IHC, IHC-P, ICC
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for EMR1 Antibody (NBP2-13960) (0)

There are no publications for EMR1 Antibody (NBP2-13960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMR1 Antibody (NBP2-13960) (0)

There are no reviews for EMR1 Antibody (NBP2-13960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EMR1 Antibody (NBP2-13960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EMR1 Antibody (NBP2-13960)

Discover related pathways, diseases and genes to EMR1 Antibody (NBP2-13960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMR1 Antibody (NBP2-13960)

Discover more about diseases related to EMR1 Antibody (NBP2-13960).

Pathways for EMR1 Antibody (NBP2-13960)

View related products by pathway.

PTMs for EMR1 Antibody (NBP2-13960)

Learn more about PTMs related to EMR1 Antibody (NBP2-13960).

Research Areas for EMR1 Antibody (NBP2-13960)

Find related products by research area.

Blogs on EMR1

There are no specific blogs for EMR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EMR1 Antibody and receive a gift card or discount.


Gene Symbol ADGRE1