EMILIN2 Antibody

Images

 
Immunohistochemistry: EMILIN2 Antibody [NBP1-91870] - Staining of human placenta shows strong membranous and additional cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Product Discontinued
View other related EMILIN2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-91870
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EMILIN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VFNTKESGMKDIKSELAEVKDTLKNKSDKLEELDGKVKGYEGQLRQLQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLK
Specificity
Specificity of human EMILIN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMILIN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMILIN2 Antibody

  • Elastin microfibril interface-located protein 2
  • elastin microfibril interfacer 2EMILIN-2
  • extracellular glycoprotein EMILIN-2
  • FLJ33200
  • FOAP-10
  • Protein FOAP-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-86460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007541-M02
Species: Hu
Applications: WB, ELISA
NB100-1687
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33931
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76911
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67560
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00079812-B01P
Species: Hu
Applications: WB, ELISA
NBP1-33479
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-64820
Species: Hu
AF1725
Species: Hu, Mu, Rt
Applications: WB, Simple Western
AF3185
Species: Hu
Applications: WB
DDX0381P-100
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for EMILIN2 Antibody (NBP1-91870) (0)

There are no publications for EMILIN2 Antibody (NBP1-91870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMILIN2 Antibody (NBP1-91870) (0)

There are no reviews for EMILIN2 Antibody (NBP1-91870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EMILIN2 Antibody (NBP1-91870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EMILIN2 Antibody (NBP1-91870)

Discover related pathways, diseases and genes to EMILIN2 Antibody (NBP1-91870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMILIN2 Antibody (NBP1-91870)

Discover more about diseases related to EMILIN2 Antibody (NBP1-91870).
 

Pathways for EMILIN2 Antibody (NBP1-91870)

View related products by pathway.

PTMs for EMILIN2 Antibody (NBP1-91870)

Learn more about PTMs related to EMILIN2 Antibody (NBP1-91870).

Blogs on EMILIN2

There are no specific blogs for EMILIN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMILIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMILIN2