EMID1 Antibody


Western Blot: EMID1 Antibody [NBP1-62472] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EMID1 Antibody Summary

Synthetic peptides corresponding to EMID1(EMI domain containing 1) The peptide sequence was selected from the C terminal of EMID1. Peptide sequence TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EMID1 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EMID1 Antibody

  • EMI domain containing 1
  • EMI5
  • Emilin and multimerin domain-containing protein 1
  • emilin and multimerin-domain containing protein 1
  • Emu1
  • EMU1EMI domain-containing protein 1
  • hEmu1
  • MGC50657
  • putative emu1


EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for EMID1 Antibody (NBP1-62472) (0)

There are no publications for EMID1 Antibody (NBP1-62472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMID1 Antibody (NBP1-62472) (0)

There are no reviews for EMID1 Antibody (NBP1-62472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMID1 Antibody (NBP1-62472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional EMID1 Products

Bioinformatics Tool for EMID1 Antibody (NBP1-62472)

Discover related pathways, diseases and genes to EMID1 Antibody (NBP1-62472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on EMID1

There are no specific blogs for EMID1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EMID1 Antibody and receive a gift card or discount.


Gene Symbol EMID1
Novus 100% Guarantee