Emerin Antibody (3B9) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Emerin Primary Antibodies

Order Details


    • Catalog Number
      H00002010-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Emerin Antibody (3B9) [PE] Summary

Immunogen
EMD (AAH00738, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPES
Specificity
EMD - emerin (Emery-Dreifuss muscular dystrophy)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EMD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Emerin Antibody (3B9) [PE]

  • emerin
  • Emery-Dreifuss muscular dystrophy
  • LEM domain containing 5
  • STAEDMDLEMD5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-59944
Species: Hu
Applications: WB, ICC/IF
H00002010-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Emerin Antibody (H00002010-M01PE) (0)

There are no publications for Emerin Antibody (H00002010-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Emerin Antibody (H00002010-M01PE) (0)

There are no reviews for Emerin Antibody (H00002010-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Emerin Antibody (H00002010-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Emerin Products

Bioinformatics Tool for Emerin Antibody (H00002010-M01PE)

Discover related pathways, diseases and genes to Emerin Antibody (H00002010-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Emerin Antibody (H00002010-M01PE)

Discover more about diseases related to Emerin Antibody (H00002010-M01PE).
 

Pathways for Emerin Antibody (H00002010-M01PE)

View related products by pathway.

PTMs for Emerin Antibody (H00002010-M01PE)

Learn more about PTMs related to Emerin Antibody (H00002010-M01PE).

Blogs on Emerin

There are no specific blogs for Emerin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Emerin Antibody (3B9) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol EMD