ELSPBP1 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit ELSPBP1 Antibody - Azide and BSA Free (NBP3-04400) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 110-223 of human ELSPBP1 (NP_071425.3). QQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWCATSYNYDQDHTWVYC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELSPBP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for ELSPBP1 Antibody - Azide and BSA Free
Background
The protein encoded by the ELSPBP1 gene belongs to the sperm-coating protein family of epididymal origin. This protein and itscanine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domainsin the Fn2-module protein family. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ICC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: WB, ICC/IF, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for ELSPBP1 Antibody (NBP3-04400) (0)
There are no publications for ELSPBP1 Antibody (NBP3-04400).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELSPBP1 Antibody (NBP3-04400) (0)
There are no reviews for ELSPBP1 Antibody (NBP3-04400).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ELSPBP1 Antibody (NBP3-04400) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ELSPBP1 Products
Research Areas for ELSPBP1 Antibody (NBP3-04400)
Find related products by research area.
|
Blogs on ELSPBP1