ELKS Antibody

Images

 
Western Blot: ELKS Antibody [NBP1-69186] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Western Blot: ELKS Antibody [NBP1-69186] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related ELKS Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69186
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ELKS Antibody Summary

Immunogen
Synthetic peptides corresponding to ERC1 (ELKS/RAB6-interacting/CAST family member 1) The peptide sequence was selected from the C terminal of ERC1. Peptide sequence KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHL.
Clonality
Polyclonal
Host
Rabbit
Gene
ERC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ERC1 and was validated on Western blot.
Theoretical MW
128 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELKS Antibody

  • ELKS/RAB6-interacting/CAST family member 1
  • ELKSCAST2
  • ERC-1
  • FLJ31750
  • KIAA1081Cast2
  • MGC12974
  • RAB6 interacting protein 2
  • Rab6-interacting protein 2
  • RAB6IP2

Background

The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13). Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
AF7935
Species: Hu
Applications: IHC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56357
Species: Hu
Applications: WB, IP
NBP1-69186
Species: Hu
Applications: WB

Publications for ELKS Antibody (NBP1-69186) (0)

There are no publications for ELKS Antibody (NBP1-69186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELKS Antibody (NBP1-69186) (0)

There are no reviews for ELKS Antibody (NBP1-69186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELKS Antibody (NBP1-69186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELKS Products

Bioinformatics Tool for ELKS Antibody (NBP1-69186)

Discover related pathways, diseases and genes to ELKS Antibody (NBP1-69186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELKS Antibody (NBP1-69186)

Discover more about diseases related to ELKS Antibody (NBP1-69186).
 

Pathways for ELKS Antibody (NBP1-69186)

View related products by pathway.

PTMs for ELKS Antibody (NBP1-69186)

Learn more about PTMs related to ELKS Antibody (NBP1-69186).

Blogs on ELKS

There are no specific blogs for ELKS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELKS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERC1
Uniprot