ELK3 Antibody

Images

 
Western Blot: ELK3 Antibody [NBP1-69119] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Small Intestine.

Product Details

Summary
Product Discontinued
View other related ELK3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69119
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ELK3 Antibody Summary

Immunogen
Synthetic peptides corresponding to Elk3 (ELK3, member of ETS oncogene family) The peptide sequence was selected from the N terminal of Elk3. Peptide sequence MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKN.
Clonality
Polyclonal
Host
Rabbit
Gene
ELK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Elk3 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELK3 Antibody

  • ELK3, ETS-domain protein (SRF accessory protein 2)
  • ERPETS domain-containing protein Elk-3
  • ETS-domain protein
  • ETS-related protein ERP
  • NETSRF accessory protein 2
  • SAP-2
  • SAP2ETS-related protein NET
  • Serum response factor accessory protein 2

Background

The function of Elk3 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-69119
Species: Mu
Applications: WB

Publications for ELK3 Antibody (NBP1-69119) (0)

There are no publications for ELK3 Antibody (NBP1-69119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELK3 Antibody (NBP1-69119) (0)

There are no reviews for ELK3 Antibody (NBP1-69119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELK3 Antibody (NBP1-69119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELK3 Products

Bioinformatics Tool for ELK3 Antibody (NBP1-69119)

Discover related pathways, diseases and genes to ELK3 Antibody (NBP1-69119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELK3 Antibody (NBP1-69119)

Discover more about diseases related to ELK3 Antibody (NBP1-69119).
 

Pathways for ELK3 Antibody (NBP1-69119)

View related products by pathway.

PTMs for ELK3 Antibody (NBP1-69119)

Learn more about PTMs related to ELK3 Antibody (NBP1-69119).

Blogs on ELK3

There are no specific blogs for ELK3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELK3