ELF3/ESE-1 Antibody (2G9)

Images

 
Western Blot: ELF3/ESE-1 Antibody (2G9) [H00001999-M05] - Analysis of ELF3 expression in A-431 (Cat # L015V1).
Sandwich ELISA: ELF3/ESE-1 Antibody (2G9) [H00001999-M05] - Detection limit for recombinant GST tagged ELF3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ELF3/ESE-1 Antibody (2G9) Summary

Immunogen
ELF3 (AAH03569 262 a.a. - 371 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
Specificity
ELF3 (2G9)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ELF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELF3/ESE-1 Antibody (2G9)

  • E74-like factor 3 (ets domain transcription factor, epithelial-specific )
  • E74-like factor 3
  • ELF3
  • Epithelial-restricted with serine box
  • epithelial-specific)
  • Epithelium-restricted Ets protein ESX
  • Epithelium-specific Ets transcription factor 1
  • EPR1
  • EPR-1
  • ERT
  • ESX
  • ets domain transcription factor, serine box (epithelial-specific)
  • ETS-related transcription factor Elf-3
  • JEN
  • serine box

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6146
Species: Hu
Applications: ICC
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for ELF3/ESE-1 Antibody (H00001999-M05) (0)

There are no publications for ELF3/ESE-1 Antibody (H00001999-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF3/ESE-1 Antibody (H00001999-M05) (0)

There are no reviews for ELF3/ESE-1 Antibody (H00001999-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF3/ESE-1 Antibody (H00001999-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELF3/ESE-1 Products

Bioinformatics Tool for ELF3/ESE-1 Antibody (H00001999-M05)

Discover related pathways, diseases and genes to ELF3/ESE-1 Antibody (H00001999-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELF3/ESE-1 Antibody (H00001999-M05)

Discover more about diseases related to ELF3/ESE-1 Antibody (H00001999-M05).
 

Pathways for ELF3/ESE-1 Antibody (H00001999-M05)

View related products by pathway.

PTMs for ELF3/ESE-1 Antibody (H00001999-M05)

Learn more about PTMs related to ELF3/ESE-1 Antibody (H00001999-M05).
 

Research Areas for ELF3/ESE-1 Antibody (H00001999-M05)

Find related products by research area.

Blogs on ELF3/ESE-1

There are no specific blogs for ELF3/ESE-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELF3/ESE-1 Antibody (2G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF3
Entrez
OMIM
Uniprot