Recombinant Human eIF5A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human eIF5A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-154 of Human EIF5A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EIF5A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eIF5A Protein

  • eIF4D
  • eIF-4D
  • eIF5A
  • EIF-5A
  • EIF5A1
  • eIF-5A1
  • eIF-5A-1
  • eIF5AI
  • Eukaryotic initiation factor 5A isoform 1
  • eukaryotic initiation factor 5A
  • eukaryotic translation initiation factor 5A
  • eukaryotic translation initiation factor 5A-1
  • MGC104255
  • MGC99547
  • Rev-binding Factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91994
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85943
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-16289
Species: Hu
Applications: WB
AF2969
Species: Mu
Applications: WB, IP
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for eIF5A Recombinant Protein (H00001984-P01) (0)

There are no publications for eIF5A Recombinant Protein (H00001984-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF5A Recombinant Protein (H00001984-P01) (0)

There are no reviews for eIF5A Recombinant Protein (H00001984-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF5A Recombinant Protein (H00001984-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF5A Products

Bioinformatics Tool for eIF5A Recombinant Protein (H00001984-P01)

Discover related pathways, diseases and genes to eIF5A Recombinant Protein (H00001984-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF5A Recombinant Protein (H00001984-P01)

Discover more about diseases related to eIF5A Recombinant Protein (H00001984-P01).
 

Pathways for eIF5A Recombinant Protein (H00001984-P01)

View related products by pathway.

PTMs for eIF5A Recombinant Protein (H00001984-P01)

Learn more about PTMs related to eIF5A Recombinant Protein (H00001984-P01).

Blogs on eIF5A

There are no specific blogs for eIF5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eIF5A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5A
Entrez