EIF5 Antibody

Images

 
Western Blot: EIF5 Antibody [NBP1-56288] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that EIF5 is expressed in HeLa

Product Details

Summary
Product Discontinued
View other related EIF5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56288
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EIF5 Antibody Summary

Immunogen
Synthetic peptides corresponding to EIF5(eukaryotic translation initiation factor 5) The peptide sequence was selected from the N terminal of EIF5. Peptide sequence SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT.
Clonality
Polyclonal
Host
Rabbit
Gene
EIF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EIF5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EIF5 Antibody

  • eIF-5
  • EIF-5A
  • eukaryotic translation initiation factor 5

Background

EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67591
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85943
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16289
Species: Hu
Applications: WB
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-91994
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP1-84877
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-16292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46580
Species: Hu
Applications: WB, IHC
NBP2-68925
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow

Publications for EIF5 Antibody (NBP1-56288) (0)

There are no publications for EIF5 Antibody (NBP1-56288).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF5 Antibody (NBP1-56288) (0)

There are no reviews for EIF5 Antibody (NBP1-56288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF5 Antibody (NBP1-56288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EIF5 Antibody (NBP1-56288)

Discover related pathways, diseases and genes to EIF5 Antibody (NBP1-56288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF5 Antibody (NBP1-56288)

Discover more about diseases related to EIF5 Antibody (NBP1-56288).
 

Pathways for EIF5 Antibody (NBP1-56288)

View related products by pathway.

PTMs for EIF5 Antibody (NBP1-56288)

Learn more about PTMs related to EIF5 Antibody (NBP1-56288).

Blogs on EIF5

There are no specific blogs for EIF5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5
Uniprot