eIF4G1 Antibody (2A9) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related eIF4G1 Primary Antibodies

Order Details


    • Catalog Number
      H00001981-M10PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

eIF4G1 Antibody (2A9) [PE] Summary

Immunogen
EIF4G1 (NP_886553 1500 a.a. - 1599 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
Specificity
EIF4G1 (2A9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF4G1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF4G1 Antibody (2A9) [PE]

  • DKFZp686A1451
  • EIF4F
  • eIF-4G 1
  • eIF4G1
  • EIF-4G1
  • eIF-4-gamma 1
  • EIF4-gamma
  • EIF4GI
  • EIF4Gp220
  • eucaryotic translation initiation factor 4G
  • eukaryotic translation initiation factor 4 gamma 1
  • eukaryotic translation initiation factor 4 gamma, 1
  • P220

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93308
Species: Hu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16309
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008569-M14
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
H00001981-M10PE
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for eIF4G1 Antibody (H00001981-M10PE) (0)

There are no publications for eIF4G1 Antibody (H00001981-M10PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4G1 Antibody (H00001981-M10PE) (0)

There are no reviews for eIF4G1 Antibody (H00001981-M10PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF4G1 Antibody (H00001981-M10PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF4G1 Products

Bioinformatics Tool for eIF4G1 Antibody (H00001981-M10PE)

Discover related pathways, diseases and genes to eIF4G1 Antibody (H00001981-M10PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4G1 Antibody (H00001981-M10PE)

Discover more about diseases related to eIF4G1 Antibody (H00001981-M10PE).
 

Pathways for eIF4G1 Antibody (H00001981-M10PE)

View related products by pathway.

PTMs for eIF4G1 Antibody (H00001981-M10PE)

Learn more about PTMs related to eIF4G1 Antibody (H00001981-M10PE).
 

Research Areas for eIF4G1 Antibody (H00001981-M10PE)

Find related products by research area.

Blogs on eIF4G1

There are no specific blogs for eIF4G1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF4G1 Antibody (2A9) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G1
Entrez