EIF3J Antibody

Images

 
Western Blot: EIF3J Antibody [H00008669-B01P] - Analysis of EIF3J expression in transfected 293T cell line by EIF3J polyclonal antibody. Lane 1: EIF3S1 transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EIF3J Antibody Summary

Immunogen
EIF3S1 (NP_003749.2, 1 a.a. - 258 a.a.) full-length human protein. MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Specificity
EIF3S1 - eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
EIF3J
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate in WB. It has been used for ELISA.
Publications
Read Publication using H00008669-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF3J Antibody

  • eIF3 p35
  • eIF3-alpha
  • eIF3j
  • eIF3-p35
  • EIF3S1eIF-3-alpha
  • Eukaryotic translation initiation factor 3 subunit 1
  • eukaryotic translation initiation factor 3 subunit J
  • eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD)
  • eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
  • eukaryotic translation initiation factor 3, subunit J

Background

Eukaryotic initiation factor-3 (EIF3) has a molecular mass of about 600 kD and contains 13 nonidentical protein subunits, including EIF3J. EIF3 plays a central role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex (Fraser et al., 2004 [PubMed 14688252]; Fraser et al., 2007 [PubMed 17588516]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24524
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-16289
Species: Hu
Applications: WB
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P

Publications for EIF3J Antibody (H00008669-B01P)(1)

Reviews for EIF3J Antibody (H00008669-B01P) (0)

There are no reviews for EIF3J Antibody (H00008669-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF3J Antibody (H00008669-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF3J Products

Bioinformatics Tool for EIF3J Antibody (H00008669-B01P)

Discover related pathways, diseases and genes to EIF3J Antibody (H00008669-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3J Antibody (H00008669-B01P)

Discover more about diseases related to EIF3J Antibody (H00008669-B01P).
 

Pathways for EIF3J Antibody (H00008669-B01P)

View related products by pathway.

PTMs for EIF3J Antibody (H00008669-B01P)

Learn more about PTMs related to EIF3J Antibody (H00008669-B01P).

Blogs on EIF3J

There are no specific blogs for EIF3J, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF3J Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3J
Entrez
Uniprot