EIF2G Antibody (2C9) - Azide and BSA Free

Western Blot: EIF2G Antibody (2C9) [H00001968-M01] - Analysis of EIF2S3 expression in transfected 293T cell line by EIF2S3 monoclonal antibody (M01), clone 2C9.Lane 1: EIF2S3 transfected lysate(51.1 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: EIF2G Antibody (2C9) [H00001968-M01] - Analysis of monoclonal antibody to EIF2S3 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: EIF2G Antibody (2C9) [H00001968-M01] - Detection limit for recombinant GST tagged EIF2S3 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2C9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EIF2G Antibody (2C9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EIF2S3 (NP_001406, 383 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
• Specificity: EIF2S3 - eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa (2C9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EIF2S3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF2G Antibody (2C9) - Azide and BSA Free

• EIF2
• eIF-2gA
• eIF-2-gamma X
• EIF2gamma
• EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
• eIF-2gX
• eukaryotic translation initiation factor 2 subunit 3
• Eukaryotic translation initiation factor 2 subunit gamma X
• eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
• eukaryotic translation initiation factor 2G

Background

eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiatortRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex.Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound toeIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round ofinitiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF2S3
• Entrez:
  • 1968(Human)
• Uniprot:
  • NP_001406(Human)