EIF2G Antibody (2C9)

Images

 
Western Blot: EIF2G Antibody (2C9) [H00001968-M01] - Analysis of EIF2S3 expression in transfected 293T cell line by EIF2S3 monoclonal antibody (M01), clone 2C9.Lane 1: EIF2S3 transfected lysate(51.1 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: EIF2G Antibody (2C9) [H00001968-M01] - Analysis of monoclonal antibody to EIF2S3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: EIF2G Antibody (2C9) [H00001968-M01] - Detection limit for recombinant GST tagged EIF2S3 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EIF2G Antibody (2C9) Summary

Immunogen
EIF2S3 (NP_001406 383 a.a. - 472 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Specificity
EIF2S3 - eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa (2C9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF2S3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF2G Antibody (2C9)

  • EIF2
  • eIF-2gA
  • eIF-2-gamma X
  • EIF2gamma
  • EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
  • eIF-2gX
  • eukaryotic translation initiation factor 2 subunit 3
  • Eukaryotic translation initiation factor 2 subunit gamma X
  • eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
  • eukaryotic translation initiation factor 2G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-58544
Species: Hu
Applications: WB, ICC/IF
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
AF3795
Species: Hu
Applications: WB, IP
22240002
Species: Hu
Applications: WB, ELISA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00004622-R01
Species: Hu
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for EIF2G Antibody (H00001968-M01) (0)

There are no publications for EIF2G Antibody (H00001968-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2G Antibody (H00001968-M01) (0)

There are no reviews for EIF2G Antibody (H00001968-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF2G Antibody (H00001968-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF2G Products

Bioinformatics Tool for EIF2G Antibody (H00001968-M01)

Discover related pathways, diseases and genes to EIF2G Antibody (H00001968-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2G Antibody (H00001968-M01)

Discover more about diseases related to EIF2G Antibody (H00001968-M01).
 

Pathways for EIF2G Antibody (H00001968-M01)

View related products by pathway.

PTMs for EIF2G Antibody (H00001968-M01)

Learn more about PTMs related to EIF2G Antibody (H00001968-M01).
 

Research Areas for EIF2G Antibody (H00001968-M01)

Find related products by research area.

Blogs on EIF2G

There are no specific blogs for EIF2G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF2G Antibody (2C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S3
Entrez
Uniprot