EHD4 Antibody (1B8) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related EHD4 Primary Antibodies

Order Details


    • Catalog Number
      H00030844-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EHD4 Antibody (1B8) [PE] Summary

Immunogen
EHD4 (AAH06287, 1 a.a. ~ 542 a.a) full length recombinant protein with GST tag.MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEA YRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQ DFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFR KLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRI SRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAF RGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGK
Localization
Endoplasmic reticulum and Nuclear
Specificity
EHD4 - EH-domain containing 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EHD4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EHD4 Antibody (1B8) [PE]

  • EH domain containing 4
  • EH domain-containing protein 4
  • EH-domain containing 4
  • HCA10
  • HCA11
  • Hepatocellular carcinoma-associated protein 10/11
  • hepatocellular carcinoma-associated protein HCA11
  • ortholog of rat pincher
  • PAST homolog 4
  • PAST4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF2848
Species: Hu, Mu
Applications: WB, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-93614
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00030844-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for EHD4 Antibody (H00030844-M01PE) (0)

There are no publications for EHD4 Antibody (H00030844-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EHD4 Antibody (H00030844-M01PE) (0)

There are no reviews for EHD4 Antibody (H00030844-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EHD4 Antibody (H00030844-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EHD4 Products

Bioinformatics Tool for EHD4 Antibody (H00030844-M01PE)

Discover related pathways, diseases and genes to EHD4 Antibody (H00030844-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD4 Antibody (H00030844-M01PE)

Discover more about diseases related to EHD4 Antibody (H00030844-M01PE).
 

Pathways for EHD4 Antibody (H00030844-M01PE)

View related products by pathway.

PTMs for EHD4 Antibody (H00030844-M01PE)

Learn more about PTMs related to EHD4 Antibody (H00030844-M01PE).

Blogs on EHD4

There are no specific blogs for EHD4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHD4 Antibody (1B8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD4