EGR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EGR2 Antibody [NBP2-58652] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EGR2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHL
Specificity
Specificity of human EGR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EGR2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EGR2 Recombinant Protein Antigen (NBP2-58652PEP)

Reactivity Notes

Mouse 83%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EGR2 Antibody

  • AT591
  • CMT1D
  • CMT4E
  • early growth response 2 (Krox-20 homolog, Drosophila)
  • early growth response 2
  • early growth response protein 2
  • EGR-2
  • FLJ14547
  • Krox-20 homolog, Drosophila
  • KROX-20, Drosophila, homolog (early growth response-2)
  • KROX20DKFZp686J1957
  • Zinc finger protein Krox-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2818
Species: Hu
Applications: WB, ICC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
MAB6979
Species: Hu
Applications: WB
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27559
Species: Hu
Applications: WB, PEP-ELISA
AF2864
Species: Hu
Applications: WB, ICC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-80999
Species: Hu
Applications: IHC, IHC-P
NBP2-19462
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45718
Species: Hu
Applications: WB, Flow, IHC

Publications for EGR2 Antibody (NBP2-58652) (0)

There are no publications for EGR2 Antibody (NBP2-58652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGR2 Antibody (NBP2-58652) (0)

There are no reviews for EGR2 Antibody (NBP2-58652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EGR2 Antibody (NBP2-58652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EGR2 Antibody (NBP2-58652)

Discover related pathways, diseases and genes to EGR2 Antibody (NBP2-58652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGR2 Antibody (NBP2-58652)

Discover more about diseases related to EGR2 Antibody (NBP2-58652).
 

Pathways for EGR2 Antibody (NBP2-58652)

View related products by pathway.

PTMs for EGR2 Antibody (NBP2-58652)

Learn more about PTMs related to EGR2 Antibody (NBP2-58652).
 

Research Areas for EGR2 Antibody (NBP2-58652)

Find related products by research area.

Blogs on EGR2

There are no specific blogs for EGR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EGR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EGR2