EGR2 Antibody (1G5)

Product Discontinued

EGR2 Antibody (1G5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EGR2 (NP_000390.2 217 a.a. - 293 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
• Specificity: Reacts with early growth response 2 (Krox-20 homolog, Drosophila).
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EGR2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EGR2 Antibody (1G5)

• AT591
• CMT1D
• CMT4E
• early growth response 2 (Krox-20 homolog, Drosophila)
• early growth response 2
• early growth response protein 2
• EGR-2
• FLJ14547
• Krox-20 homolog, Drosophila
• KROX-20, Drosophila, homolog (early growth response-2)
• KROX20DKFZp686J1957
• Zinc finger protein Krox-20

Background

The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EGR2
• Entrez:
  • 1959(Human)
• Uniprot:
  • NP_000390(Human)