EGR1 Antibody


Western Blot: Egr1 Antibody [NBP1-52918] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Product Discontinued
View other related EGR1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EGR1 Antibody Summary

Synthetic peptides corresponding to EGR1(early growth response 1) The peptide sequence was selected from the middle region of EGR1. Peptide sequence PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EGR1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EGR1 Antibody

  • AT225Transcription factor ETR103
  • early growth response 1
  • early growth response protein 1
  • EGR1
  • EGR-1
  • G0S30
  • KROX24
  • KROX-24
  • Nerve growth factor-induced protein A
  • NGFI-ATranscription factor Zif268
  • TIS8
  • ZIF-268
  • Zinc finger protein Krox-24
  • ZNF225
  • ZNF225Zinc finger protein 225


Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a tr


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EGR1 Antibody (NBP1-52918) (0)

There are no publications for EGR1 Antibody (NBP1-52918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGR1 Antibody (NBP1-52918) (0)

There are no reviews for EGR1 Antibody (NBP1-52918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EGR1 Antibody (NBP1-52918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EGR1 Products

Bioinformatics Tool for EGR1 Antibody (NBP1-52918)

Discover related pathways, diseases and genes to EGR1 Antibody (NBP1-52918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGR1 Antibody (NBP1-52918)

Discover more about diseases related to EGR1 Antibody (NBP1-52918).

Pathways for EGR1 Antibody (NBP1-52918)

View related products by pathway.

PTMs for EGR1 Antibody (NBP1-52918)

Learn more about PTMs related to EGR1 Antibody (NBP1-52918).

Research Areas for EGR1 Antibody (NBP1-52918)

Find related products by research area.

Blogs on EGR1.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

No Monkey Business: APE1 is a Critical DNA Repair Enzyme
APE1 (aka. HAP1, /Ref-1 or APEX) the mammalian ortholog of Escherichia coli Xth is a multifunctional protein possessing both DNA repair and transcriptional regulatory activity. APE1 acts essentially as master regulator of controlling cellular response...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EGR1 Antibody and receive a gift card or discount.


Gene Symbol EGR1