EGR1 Antibody

Product Details

Product Discontinued
View other related EGR1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EGR1 Antibody Summary

Synthetic peptides corresponding to EGR1(early growth response 1) The peptide sequence was selected from the middle region of EGR1. Peptide sequence PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified

Application Notes
This is a rabbit polyclonal antibody against EGR1 and was validated on Western blot.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a tr

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, Flow, IHC, ICC
Species: Hu, Po
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB

Publications for EGR1 Antibody (NBP1-52918) (0)

There are no publications for EGR1 Antibody (NBP1-52918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGR1 Antibody (NBP1-52918) (0)

There are no reviews for EGR1 Antibody (NBP1-52918). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for EGR1 Antibody (NBP1-52918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGR1 Antibody Products

Related Products by Gene

Bioinformatics Tool for EGR1 Antibody (NBP1-52918)

Discover related pathways, diseases and genes to EGR1 Antibody (NBP1-52918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGR1 Antibody (NBP1-52918)

Discover more about diseases related to EGR1 Antibody (NBP1-52918).

Pathways for EGR1 Antibody (NBP1-52918)

View related products by pathway.

PTMs for EGR1 Antibody (NBP1-52918)

Learn more about PTMs related to EGR1 Antibody (NBP1-52918).

Blogs on EGR1.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

No Monkey Business: APE1 is a Critical DNA Repair Enzyme
APE1 (aka. HAP1, /Ref-1 or APEX) the mammalian ortholog of Escherichia coli Xth is a multifunctional protein possessing both DNA repair and transcriptional regulatory activity. APE1 acts essentially as master regulator of controlling cellular response...  Read full blog post.

Contact Information

Product PDFs

Gene Symbol EGR1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-52918 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.