Recombinant Rat EGF Protein

Images

 

Product Details

Summary
Product Discontinued
View other related EGF Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-99877
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Rat EGF Protein Summary

Description
A recombinant protein corresponding to 53 amino acids of Rat EGF

Amino Acid Sequence: NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Preparation
Method
>98% SDS-PAGE
Details of Functionality
Biological Activity: The ED50 as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of > 1 x 10^7units/mg.
Results: <0.1 ng/ml
Protein/Peptide Type
Recombinant Protein
Gene
EGF
Purity
>90% SDS-PAGE

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS, pH 7.4.
Concentration
Lyoph
Purity
>90% SDS-PAGE
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized water to a final concentration greater than or equal to 0.1 mg/ml.

Notes

After reconstituted, dilute further with other aqueous solutions.

Alternate Names for Recombinant Rat EGF Protein

  • beta-urogastrone
  • EGF
  • epidermal growth factor (beta-urogastrone)
  • epidermal growth factor
  • HOMG4
  • pro-epidermal growth factor
  • URG
  • Urogastrone

Background

Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for EGF Protein (NBP1-99877) (0)

There are no publications for EGF Protein (NBP1-99877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGF Protein (NBP1-99877) (0)

There are no reviews for EGF Protein (NBP1-99877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for EGF Protein (NBP1-99877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGF Products

Bioinformatics Tool for EGF Protein (NBP1-99877)

Discover related pathways, diseases and genes to EGF Protein (NBP1-99877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGF Protein (NBP1-99877)

Discover more about diseases related to EGF Protein (NBP1-99877).
 

Pathways for EGF Protein (NBP1-99877)

View related products by pathway.

PTMs for EGF Protein (NBP1-99877)

Learn more about PTMs related to EGF Protein (NBP1-99877).

Blogs on EGF.

Using EGF Protein from Novus Biologicals
EGF (epidermal growth factor) stimulates differentiation, proliferation and cell growth by binding to its receptor, EGFR. EGF was first discovered in the mouse submandibular gland in 1986 by Stanley Cohen of Vanderbilt University, leading to a Nobel P...  Read full blog post.

Myosin is More than Just a Heavy Lifter
Myosin is a well-known, hexameric molecular motor that is a key cytoskeletal component. It consists of a pair of myosin heavy chain subunits (MHC), a pair of essential myosin light chain subunits (MLC), and a pair of regulatory light chain subunits (R...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Rat EGF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EGF
Entrez