Recombinant Human eEF1A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human eEF1A1 Protein Summary

Description
EEF1A1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK
Protein/Peptide Type
Partial Recombinant Protein
Gene
EEF1A1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eEF1A1 Protein

  • CCS3
  • CCS-3
  • cervical cancer suppressor 3
  • CTCL tumor antigen
  • EE1A1
  • EEF-1
  • EEF1A
  • eEF1A-1
  • EF1AHNGC:16303
  • EF1a-like protein
  • EF-1-alpha-1
  • EF-Tu
  • elongation factor 1 alpha subunit
  • elongation factor 1-alpha 1
  • Elongation factor Tu
  • Eukaryotic elongation factor 1 A-1
  • eukaryotic translation elongation factor 1 alpha 1
  • eukaryotic translation elongation factor 1 alpha 1-like 14
  • FLJ25721
  • glucocorticoid receptor AF-1 specific elongation factor
  • GRAF-1EF
  • LENG7
  • leukocyte receptor cluster (LRC) member 7
  • Leukocyte receptor cluster member 7
  • MGC102687
  • MGC131894
  • MGC16224
  • prostate tumor-inducing protein 1
  • PTI1
  • translation elongation factor 1 alpha 1-like 14

Background

EEF1A1 - eukaryotic translation elongation factor 1 alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14041
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42820
Species: Hu, Mu, Rt, Rb
Applications: WB, B/N, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-36638
Species: Hu
Applications: IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IP, ChIP
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00028299-P01
Species: Hu
H00009669-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for eEF1A1 Partial Recombinant Protein (H00001915-Q01) (0)

There are no publications for eEF1A1 Partial Recombinant Protein (H00001915-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eEF1A1 Partial Recombinant Protein (H00001915-Q01) (0)

There are no reviews for eEF1A1 Partial Recombinant Protein (H00001915-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eEF1A1 Partial Recombinant Protein (H00001915-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human eEF1A1 Protein Products

Related Products by Gene

Bioinformatics Tool for eEF1A1 Partial Recombinant Protein (H00001915-Q01)

Discover related pathways, diseases and genes to eEF1A1 Partial Recombinant Protein (H00001915-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eEF1A1 Partial Recombinant Protein (H00001915-Q01)

Discover more about diseases related to eEF1A1 Partial Recombinant Protein (H00001915-Q01).
 

Pathways for eEF1A1 Partial Recombinant Protein (H00001915-Q01)

View related products by pathway.

PTMs for eEF1A1 Partial Recombinant Protein (H00001915-Q01)

Learn more about PTMs related to eEF1A1 Partial Recombinant Protein (H00001915-Q01).

Blogs on eEF1A1

There are no specific blogs for eEF1A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eEF1A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1A1

Customers Who Bought This Also Bought

eEF1A1 Antibody (23C11)
NBP2-59411-100ul
eEF1A1 Antibody (23C11)
NBP2-59411-100ul