EDRF1 Antibody

Images

 
Western Blot: EDRF1 Antibody [NBP2-84019] - Host: Rabbit. Target Name: C10orf137. Sample Type: MCF7 Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDRF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the Middle region of Human EDRF1. Peptide sequence: LCGDIQLMLAQNANNRAAHLEEFHYQTKED The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
C10ORF137
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EDRF1 Antibody

  • C10orf137
  • chromosome 10 open reading frame 137
  • RP11-383C5.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-82580
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP3-05569
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP1-19388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-574
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-84008
Species: Hu
Applications: IHC, IHC-P
7954-GM/CF
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF611
Species: Mu
Applications: WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86371
Species: Hu
Applications: IHC, IHC-P

Publications for EDRF1 Antibody (NBP2-84019) (0)

There are no publications for EDRF1 Antibody (NBP2-84019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDRF1 Antibody (NBP2-84019) (0)

There are no reviews for EDRF1 Antibody (NBP2-84019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDRF1 Antibody (NBP2-84019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDRF1 Products

Array NBP2-84019

Bioinformatics Tool for EDRF1 Antibody (NBP2-84019)

Discover related pathways, diseases and genes to EDRF1 Antibody (NBP2-84019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDRF1 Antibody (NBP2-84019)

Discover more about diseases related to EDRF1 Antibody (NBP2-84019).

Blogs on EDRF1

There are no specific blogs for EDRF1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDRF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C10ORF137