EDIL3/DEL1 Antibody


Western Blot: EDIL3/DEL1 Antibody [NBP2-13946] - Analysis in human cell line U-2 OS.
Immunohistochemistry-Paraffin: EDIL3/DEL1 Antibody [NBP2-13946] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Product Discontinued
View other related EDIL3/DEL1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EDIL3/DEL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASST HRALFGLQKWYPYYARLNKKGLINAWTAAE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EDIL3/DEL1 Antibody

  • DEL1
  • DEL1developmental endothelial locus-1
  • Developmentally-regulated endothelial cell locus 1 protein
  • EDIL3
  • EGF-like repeat and discoidin I-like domain-containing protein 3
  • EGF-like repeats and discoidin I-like domains 3
  • Integrin-binding protein DEL1
  • MGC26287


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vivo
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for EDIL3/DEL1 Antibody (NBP2-13946) (0)

There are no publications for EDIL3/DEL1 Antibody (NBP2-13946).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDIL3/DEL1 Antibody (NBP2-13946) (0)

There are no reviews for EDIL3/DEL1 Antibody (NBP2-13946). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDIL3/DEL1 Antibody (NBP2-13946) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EDIL3/DEL1 Products

Bioinformatics Tool for EDIL3/DEL1 Antibody (NBP2-13946)

Discover related pathways, diseases and genes to EDIL3/DEL1 Antibody (NBP2-13946). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDIL3/DEL1 Antibody (NBP2-13946)

Discover more about diseases related to EDIL3/DEL1 Antibody (NBP2-13946).

Pathways for EDIL3/DEL1 Antibody (NBP2-13946)

View related products by pathway.

Research Areas for EDIL3/DEL1 Antibody (NBP2-13946)

Find related products by research area.

Blogs on EDIL3/DEL1

There are no specific blogs for EDIL3/DEL1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EDIL3/DEL1 Antibody and receive a gift card or discount.


Gene Symbol EDIL3