ECHS1 Antibody

Images

 
Western Blot: ECHS1 Antibody [NBP1-54698] - Human Liver cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Product Discontinued
View other related ECHS1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54698
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ECHS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ECHS1(enoyl Coenzyme A hydratase, short chain, 1, mitochondrial) The peptide sequence was selected from the middle region of ECHS1. Peptide sequence RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA.
Clonality
Polyclonal
Host
Rabbit
Gene
ECHS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ECHS1 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ECHS1 Antibody

  • EC 4.2.1
  • enoyl CoA hydratase, short chain, 1, mitochondrial
  • enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  • Enoyl-CoA hydratase 1
  • enoyl-CoA hydratase, mitochondrial
  • SCEHEC 4.2.1.17
  • Short-chain enoyl-CoA hydratase

Background

ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-88364
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16429
Species: Hu
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-16700
Species: Hu, Mu
Applications: WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-92431
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
NBP1-54698
Species: Hu
Applications: WB

Publications for ECHS1 Antibody (NBP1-54698) (0)

There are no publications for ECHS1 Antibody (NBP1-54698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECHS1 Antibody (NBP1-54698) (0)

There are no reviews for ECHS1 Antibody (NBP1-54698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ECHS1 Antibody (NBP1-54698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECHS1 Products

Bioinformatics Tool for ECHS1 Antibody (NBP1-54698)

Discover related pathways, diseases and genes to ECHS1 Antibody (NBP1-54698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECHS1 Antibody (NBP1-54698)

Discover more about diseases related to ECHS1 Antibody (NBP1-54698).
 

Pathways for ECHS1 Antibody (NBP1-54698)

View related products by pathway.

PTMs for ECHS1 Antibody (NBP1-54698)

Learn more about PTMs related to ECHS1 Antibody (NBP1-54698).
 

Research Areas for ECHS1 Antibody (NBP1-54698)

Find related products by research area.

Blogs on ECHS1

There are no specific blogs for ECHS1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECHS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECHS1
Uniprot