E6AP/UBE3A Antibody (2F6) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related E6AP/UBE3A Primary Antibodies

Order Details


    • Catalog Number
      H00007337-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

E6AP/UBE3A Antibody (2F6) [DyLight 405] Summary

Immunogen
UBE3A (AAH09271, 51 a.a. - 150 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCR
Specificity
UBE3A - ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 405
Format
DyLight 405 (A=400, E=420)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for E6AP/UBE3A Antibody (2F6) [DyLight 405]

  • ANCR
  • ANCREPVE6AP
  • AS
  • CTCL tumor antigen se37-2
  • E6AP ubiquitin-protein ligase
  • E6AP
  • E6-AP
  • EC 6.3.2.-
  • EPVE6AP
  • FLJ26981
  • HPVE6A
  • human papilloma virus E6-associated protein
  • Human papillomavirus E6-associated protein
  • Oncogenic protein-associated protein E6-AP
  • Renal carcinoma antigen NY-REN-54
  • UBE3A
  • ubiquitin protein ligase E3A
  • ubiquitin-protein ligase E3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1489
Species: Hu
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-FrFl
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89180
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30505
Species: Hu
Applications: IHC, IHC-P

Publications for E6AP/UBE3A Antibody (H00007337-M01V) (0)

There are no publications for E6AP/UBE3A Antibody (H00007337-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E6AP/UBE3A Antibody (H00007337-M01V) (0)

There are no reviews for E6AP/UBE3A Antibody (H00007337-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for E6AP/UBE3A Antibody (H00007337-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E6AP/UBE3A Antibody (2F6) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for E6AP/UBE3A Antibody (H00007337-M01V)

Discover related pathways, diseases and genes to E6AP/UBE3A Antibody (H00007337-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E6AP/UBE3A Antibody (H00007337-M01V)

Discover more about diseases related to E6AP/UBE3A Antibody (H00007337-M01V).
 

Pathways for E6AP/UBE3A Antibody (H00007337-M01V)

View related products by pathway.

PTMs for E6AP/UBE3A Antibody (H00007337-M01V)

Learn more about PTMs related to E6AP/UBE3A Antibody (H00007337-M01V).
 

Research Areas for E6AP/UBE3A Antibody (H00007337-M01V)

Find related products by research area.

Blogs on E6AP/UBE3A

There are no specific blogs for E6AP/UBE3A, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our E6AP/UBE3A Antibody (2F6) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE3A
Entrez
Uniprot