E-Selectin/CD62E Antibody

Images

 
Western Blot: E-Selectin/CD62E Antibody [H00006401-B01P] - Analysis of SELE expression in transfected 293T cell line by SELE polyclonal antibody. Lane 1: SELE transfected lysate(67.1 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

E-Selectin/CD62E Antibody Summary

Immunogen
SELE (NP_000441.1, 1 a.a. - 610 a.a.) full-length human protein. MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELYGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Specificity
SELE - selectin E (endothelial adhesion molecule 1),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SELE
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for E-Selectin/CD62E Antibody

  • CD62 antigen-like family member E
  • CD62E antigen
  • CD62E
  • ELAM
  • ELAM1
  • ELAM-1
  • ELAM1E-selectin
  • endothelial adhesion molecule 1
  • Endothelial leukocyte adhesion molecule 1
  • ESEL
  • E-Selectin
  • LECAM2
  • leukocyte endothelial cell adhesion molecule 2
  • Leukocyte-endothelial cell adhesion molecule 2
  • SELE
  • selectin E

Background

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready

Publications for E-Selectin/CD62E Antibody (H00006401-B01P) (0)

There are no publications for E-Selectin/CD62E Antibody (H00006401-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E-Selectin/CD62E Antibody (H00006401-B01P) (0)

There are no reviews for E-Selectin/CD62E Antibody (H00006401-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E-Selectin/CD62E Antibody (H00006401-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E-Selectin/CD62E Products

Bioinformatics Tool for E-Selectin/CD62E Antibody (H00006401-B01P)

Discover related pathways, diseases and genes to E-Selectin/CD62E Antibody (H00006401-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E-Selectin/CD62E Antibody (H00006401-B01P)

Discover more about diseases related to E-Selectin/CD62E Antibody (H00006401-B01P).
 

Pathways for E-Selectin/CD62E Antibody (H00006401-B01P)

View related products by pathway.

PTMs for E-Selectin/CD62E Antibody (H00006401-B01P)

Learn more about PTMs related to E-Selectin/CD62E Antibody (H00006401-B01P).
 

Research Areas for E-Selectin/CD62E Antibody (H00006401-B01P)

Find related products by research area.

Blogs on E-Selectin/CD62E

There are no specific blogs for E-Selectin/CD62E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E-Selectin/CD62E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SELE
Entrez
Uniprot