DYX1C1 Partial Protein

Images

 
SDS-Page: DYX1C1 Partial Protein [H00161582-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

DYX1C1 Partial Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 336-420 of Human DYX1C1

Source: Wheat Germ

Amino Acid Sequence: KLKNLHKAIEDSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Protein
Gene
DYX1C1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.09 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DYX1C1 Partial Protein

  • dyslexia susceptibility 1 candidate 1
  • dyslexia susceptibility 1 candidate gene 1 protein
  • DYX1
  • DYXC1
  • EKN1MGC70618
  • FLJ37882
  • RD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00005555-P01
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
H00161582-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for DYX1C1 Partial Recombinant Protein (H00161582-Q01) (0)

There are no publications for DYX1C1 Partial Recombinant Protein (H00161582-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYX1C1 Partial Recombinant Protein (H00161582-Q01) (0)

There are no reviews for DYX1C1 Partial Recombinant Protein (H00161582-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DYX1C1 Partial Recombinant Protein (H00161582-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DYX1C1 Products

Bioinformatics Tool for DYX1C1 Partial Recombinant Protein (H00161582-Q01)

Discover related pathways, diseases and genes to DYX1C1 Partial Recombinant Protein (H00161582-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYX1C1 Partial Recombinant Protein (H00161582-Q01)

Discover more about diseases related to DYX1C1 Partial Recombinant Protein (H00161582-Q01).
 

Pathways for DYX1C1 Partial Recombinant Protein (H00161582-Q01)

View related products by pathway.

PTMs for DYX1C1 Partial Recombinant Protein (H00161582-Q01)

Learn more about PTMs related to DYX1C1 Partial Recombinant Protein (H00161582-Q01).
 

Research Areas for DYX1C1 Partial Recombinant Protein (H00161582-Q01)

Find related products by research area.

Blogs on DYX1C1

There are no specific blogs for DYX1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DYX1C1 Antibody
NBP2-47476

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYX1C1 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DYX1C1