Dystonin Antibody (1B10) [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Dystonin Primary Antibodies

Order Details


    • Catalog Number
      H00000667-M01AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Dystonin Antibody (1B10) [Alexa Fluor® 405] Summary

Immunogen
DST (NP_899236 401 a.a. - 500 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
Specificity
DST - dystonin
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DST
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for Dystonin Antibody (1B10) [Alexa Fluor® 405]

  • 230 kDa bullous pemphigoid antigen
  • BP240
  • BPAFLJ30627
  • BPAG1FLJ32235
  • Bullous pemphigoid antigen 1
  • bullous pemphigoid antigen 1, 230/240kDa
  • Bullous pemphigoid antigen
  • CATX-15
  • D6S1101
  • DKFZp564B2416
  • DMHCATX15
  • DT
  • Dystonia musculorum protein
  • dystonin
  • FLJ13425
  • FLJ21489
  • FLJ46791
  • Hemidesmosomal plaque protein
  • KIAA0465
  • KIAA0728
  • KIAA1470
  • MACF2
  • trabeculin-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
259-HE
Species: Hu
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00000667-M01AF405
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Dystonin Antibody (H00000667-M01AF405) (0)

There are no publications for Dystonin Antibody (H00000667-M01AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystonin Antibody (H00000667-M01AF405) (0)

There are no reviews for Dystonin Antibody (H00000667-M01AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dystonin Antibody (H00000667-M01AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dystonin Products

Bioinformatics Tool for Dystonin Antibody (H00000667-M01AF405)

Discover related pathways, diseases and genes to Dystonin Antibody (H00000667-M01AF405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystonin Antibody (H00000667-M01AF405)

Discover more about diseases related to Dystonin Antibody (H00000667-M01AF405).
 

Pathways for Dystonin Antibody (H00000667-M01AF405)

View related products by pathway.

PTMs for Dystonin Antibody (H00000667-M01AF405)

Learn more about PTMs related to Dystonin Antibody (H00000667-M01AF405).
 

Research Areas for Dystonin Antibody (H00000667-M01AF405)

Find related products by research area.

Blogs on Dystonin

There are no specific blogs for Dystonin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dystonin Antibody (1B10) [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol DST