DYRK2 Antibody (6E2.) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related DYRK2 Primary Antibodies

Order Details


    • Catalog Number
      H00008445-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DYRK2 Antibody (6E2.) [PE] Summary

Immunogen
DYRK2 (AAH05809, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH
Specificity
DYRK2 - dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DYRK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DYRK2 Antibody (6E2.) [PE]

  • dual specificity tyrosine-phosphorylation-regulated kinase 2
  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
  • DYRK2
  • EC 2.7.12
  • EC 2.7.12.1
  • FLJ21217
  • FLJ21365

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF5409
Species: Hu, Mu, Rt
Applications: WB
NBP1-33464
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26626
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
H00008445-M02PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for DYRK2 Antibody (H00008445-M02PE) (0)

There are no publications for DYRK2 Antibody (H00008445-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYRK2 Antibody (H00008445-M02PE) (0)

There are no reviews for DYRK2 Antibody (H00008445-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DYRK2 Antibody (H00008445-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYRK2 Products

Bioinformatics Tool for DYRK2 Antibody (H00008445-M02PE)

Discover related pathways, diseases and genes to DYRK2 Antibody (H00008445-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYRK2 Antibody (H00008445-M02PE)

Discover more about diseases related to DYRK2 Antibody (H00008445-M02PE).
 

Pathways for DYRK2 Antibody (H00008445-M02PE)

View related products by pathway.

PTMs for DYRK2 Antibody (H00008445-M02PE)

Learn more about PTMs related to DYRK2 Antibody (H00008445-M02PE).
 

Research Areas for DYRK2 Antibody (H00008445-M02PE)

Find related products by research area.

Blogs on DYRK2

There are no specific blogs for DYRK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYRK2 Antibody (6E2.) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK2
Entrez