DYRK1A Antibody

Images

 
Western Blot: DYRK1A Antibody [NBP1-69025] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Summary
Product Discontinued
View other related DYRK1A Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69025
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DYRK1A Antibody Summary

Immunogen
Synthetic peptides corresponding to Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a) The peptide sequence was selected from the N terminal of Dyrk1a. Peptide sequence SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLT
Clonality
Polyclonal
Host
Rabbit
Gene
DYRK1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Dyrk1a and was validated on Western blot.
Theoretical MW
85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DYRK1A Antibody

  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  • DYRK1
  • DYRK1A
  • MNBEC 2.7.110EC 2.7.12
  • MNBH

Background

Dyrk1a may play a role in a signaling pathway regulating nuclear functions of cell proliferation. Dyrk1a phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33464
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-94452
Species: Hu, Ch, Mu(-), Rt(-)
Applications: WB, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
AF5409
Species: Hu, Mu, Rt
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for DYRK1A Antibody (NBP1-69025) (0)

There are no publications for DYRK1A Antibody (NBP1-69025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYRK1A Antibody (NBP1-69025) (0)

There are no reviews for DYRK1A Antibody (NBP1-69025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DYRK1A Antibody (NBP1-69025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYRK1A Products

Bioinformatics Tool for DYRK1A Antibody (NBP1-69025)

Discover related pathways, diseases and genes to DYRK1A Antibody (NBP1-69025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYRK1A Antibody (NBP1-69025)

Discover more about diseases related to DYRK1A Antibody (NBP1-69025).
 

Pathways for DYRK1A Antibody (NBP1-69025)

View related products by pathway.

PTMs for DYRK1A Antibody (NBP1-69025)

Learn more about PTMs related to DYRK1A Antibody (NBP1-69025).

Blogs on DYRK1A

There are no specific blogs for DYRK1A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYRK1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK1A
Entrez
Uniprot