dUTPase Antibody

Images

 
Western Blot: dUTPase Antibody [NBP1-53017] - Jurkat tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP1-53017] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

dUTPase Antibody Summary

Immunogen
Synthetic peptides corresponding to DUT(dUTP pyrophosphatase) The peptide sequence was selected from the C terminal of dUTPase. Peptide sequence NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against dUTPase and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for dUTPase Antibody

  • deoxyuridine triphosphatase
  • dUTP pyrophosphatasedUTP nucleotidohydrolase
  • dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
  • EC 3.6.1.23
  • FLJ20622

Background

DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA

Publications for dUTPase Antibody (NBP1-53017) (0)

There are no publications for dUTPase Antibody (NBP1-53017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dUTPase Antibody (NBP1-53017) (0)

There are no reviews for dUTPase Antibody (NBP1-53017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for dUTPase Antibody (NBP1-53017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional dUTPase Products

Bioinformatics Tool for dUTPase Antibody (NBP1-53017)

Discover related pathways, diseases and genes to dUTPase Antibody (NBP1-53017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for dUTPase Antibody (NBP1-53017)

Discover more about diseases related to dUTPase Antibody (NBP1-53017).
 

Pathways for dUTPase Antibody (NBP1-53017)

View related products by pathway.

PTMs for dUTPase Antibody (NBP1-53017)

Learn more about PTMs related to dUTPase Antibody (NBP1-53017).
 

Research Areas for dUTPase Antibody (NBP1-53017)

Find related products by research area.

Blogs on dUTPase

There are no specific blogs for dUTPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our dUTPase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUT
Uniprot