Recombinant Human DUSP9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DUSP9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-105 of Human DUSP9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DUSP9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
10 mM Na2PO4, pH 7.5.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DUSP9 Protein

  • dual specificity phosphatase 9
  • EC 3.1.3.16
  • EC 3.1.3.48
  • MAP kinase phosphatase 4
  • Mitogen-activated protein kinase phosphatase 4
  • MKP-4dual specificity protein phosphatase 9
  • MKP4serine/threonine specific protein phosphatase

Background

DUSP9 - dual specificity phosphatase 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31232
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00001852-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DUSP9 Partial Recombinant Protein (H00001852-Q01) (0)

There are no publications for DUSP9 Partial Recombinant Protein (H00001852-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP9 Partial Recombinant Protein (H00001852-Q01) (0)

There are no reviews for DUSP9 Partial Recombinant Protein (H00001852-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP9 Partial Recombinant Protein (H00001852-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DUSP9 Products

Bioinformatics Tool for DUSP9 Partial Recombinant Protein (H00001852-Q01)

Discover related pathways, diseases and genes to DUSP9 Partial Recombinant Protein (H00001852-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP9 Partial Recombinant Protein (H00001852-Q01)

Discover more about diseases related to DUSP9 Partial Recombinant Protein (H00001852-Q01).
 

Pathways for DUSP9 Partial Recombinant Protein (H00001852-Q01)

View related products by pathway.

PTMs for DUSP9 Partial Recombinant Protein (H00001852-Q01)

Learn more about PTMs related to DUSP9 Partial Recombinant Protein (H00001852-Q01).
 

Research Areas for DUSP9 Partial Recombinant Protein (H00001852-Q01)

Find related products by research area.

Blogs on DUSP9

There are no specific blogs for DUSP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DUSP9 Antibody
NBP1-31227

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DUSP9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP9