DUSP5 Antibody (2F3) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related DUSP5 Primary Antibodies

Order Details


    • Catalog Number
      H00001847-M04PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DUSP5 Antibody (2F3) [PerCP] Summary

Immunogen
DUSP5 (NP_004410 286 a.a. - 384 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Specificity
DUSP5 - dual specificity phosphatase 5
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DUSP5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DUSP5 Antibody (2F3) [PerCP]

  • dual specificity phosphatase 5
  • dual specificity protein phosphatase 5
  • Dual specificity protein phosphatase hVH3
  • DUSP
  • EC 3.1.3.16
  • EC 3.1.3.48
  • HVH3VH1-like phosphatase 3
  • serine/threonine specific protein phosphatase
  • VH3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001846-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF3720
Species: Hu, Mu
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001847-M04PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for DUSP5 Antibody (H00001847-M04PCP) (0)

There are no publications for DUSP5 Antibody (H00001847-M04PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP5 Antibody (H00001847-M04PCP) (0)

There are no reviews for DUSP5 Antibody (H00001847-M04PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DUSP5 Antibody (H00001847-M04PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP5 Products

Bioinformatics Tool for DUSP5 Antibody (H00001847-M04PCP)

Discover related pathways, diseases and genes to DUSP5 Antibody (H00001847-M04PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP5 Antibody (H00001847-M04PCP)

Discover more about diseases related to DUSP5 Antibody (H00001847-M04PCP).
 

Pathways for DUSP5 Antibody (H00001847-M04PCP)

View related products by pathway.

PTMs for DUSP5 Antibody (H00001847-M04PCP)

Learn more about PTMs related to DUSP5 Antibody (H00001847-M04PCP).
 

Research Areas for DUSP5 Antibody (H00001847-M04PCP)

Find related products by research area.

Blogs on DUSP5

There are no specific blogs for DUSP5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP5 Antibody (2F3) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP5