Home » DUSP19 » DUSP19 Antibodies » DUSP19 Antibody

DUSP19 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DUSP19 Antibody [NBP1-84041] - Analysis in control (vector only transfected HEK293T lysate) and DUSP19 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: DUSP19 Antibody [NBP1-84041] - Analysis in control (vector only transfected HEK293T lysate) and DUSP19 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: DUSP19 Antibody [NBP1-84041] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DUSP19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
Specificity
Specificity of human DUSP19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DUSP19 Protein (NBP1-84041PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP19 Antibody

  • dual specificity phosphatase 19
  • Dual specificity phosphatase TS-DSP1
  • dual specificity protein phosphatase 19
  • DUSP17SAPK pathway-regulating phosphatase 1
  • EC 3.1.3.16
  • EC 3.1.3.48
  • LMWDSP3
  • LMW-DSP3
  • Low molecular weight dual specificity phosphatase 3
  • Protein phosphatase SKRP1
  • SKRP1MGC138210
  • Stress-activated protein kinase pathway-regulating phosphatase 1
  • TS-DSP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MKK7/MEK7 Antibody
(SD20-87)
NBP2-67764
Western Blot: MKK7/MEK7 Antibody (SD20-87) [NBP2-67764] - Analysis of MEK7 on different lysates using anti-MEK7 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: 293T Lane 3: A431
Immunocytochemistry/Immunofluorescence: MKK7/MEK7 Antibody (SD20-87) [NBP2-67764] - Staining MEK7 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MKK7/MEK7 Antibody (SD20-87) [NBP2-67764] - Analysis of paraffin-embedded rat brain tissue using anti-MEK7 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MKP-1/DUSP1
Antibody (JJ0930)
NBP2-67909
Western Blot: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of DUSP1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: NIH/3T3 cell lysateLane 2: Jurkat cell lysate Lane 3: mouse spleen tissue lysate
Immunohistochemistry-Paraffin: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of paraffin-embedded mouse lung tissue using anti-DUSP1 antibody. Counter stained with hematoxylin.
Flow Cytometry: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of HepG2 cells with DUSP1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
CDC25C Antibody
NBP2-89147
Western Blot: CDC25C Antibody [NBP2-89147] - Analysis of Cdc25C on human skin tissue lysate using anti-Cdc25C antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: CDC25C Antibody [NBP2-89147] - Staining Cdc25C in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CDC25C Antibody [NBP2-89147] - Analysis of paraffin-embedded human placenta tissue using anti-Cdc25C antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
RASGRF1 Antibody
NBP2-95233
Western Blot: RASGRF1 Antibody [NBP2-95233] - Analysis of extracts of mouse brain, using RASGRF1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure tim
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP2-95233] - Analysis of U2OS cells using RASGRF1. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP2-95233] - Paraffin-embedded human stomach using RASGRF1.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
JNK2 Antibody
(252320) [Unconjugate
MAB1846
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.2 µg/mL Mouse Anti-Human/Mouse/Rat JNK2 Monoclonal Antibody (Catalog # MAB1846) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). For additional reference, recombinant human JNK1, JNK2, and JNK3 (1 ng/lane) were included. Specific bands for JNK2 were detected at approximately 46 and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and JNK2 knockout HEK293T cell line (KO). PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human/Mouse/Rat JNK2 Monoclonal Antibody (Catalog # MAB1846) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for JNK2 at approximately 45 and 54 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # MAB5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
JNK2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Mouse/Rat JNK2 Monoclonal Antibody (Catalog # MAB1846) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC
PTPN7 Antibody
(OTI3B10)
NBP2-01340
Western Blot: PTPN7 Antibody (3B10) [NBP2-01340] Analysis of extracts (35ug) from 9 different cell lines by using anti-PTPN7 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: PTPN7 Antibody (3B10) [NBP2-01340] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY PTPN7.
Western Blot: PTPN7 Antibody (3B10) [NBP2-01340] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PTPN7 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PTPN7.
(1 Review)
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
ASK1 Antibody
NB100-81788
Western Blot: ASK1 Antibody [NB100-81788] - Analysis of extracts from 293 and Hela cells using ASK1(Ab-966) antibody
Immunocytochemistry/Immunofluorescence: ASK1 Antibody [NB100-81788] - Staining of methanol-fixed Hela cells using ASK1(Ab-966) antibody
Immunohistochemistry-Paraffin: ASK1 Antibody [NB100-81788] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using ASK1 (Ab-966) antibody.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DUSP12 Antibody
H00011266-D01P
Western Blot: DUSP12 Antibody [H00011266-D01P] - Analysis of DUSP12 expression in transfected 293T cell line by DUSP12 polyclonal antibody.Lane 1: DUSP12 transfected lysate(37.70 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: DUSP12 Antibody [H00011266-D01P] - Analysis of antibody to DUSP12 on HeLa cell. Antibody concentration 20 ug/ml.
Species: Hu
Applications: WB, ICC/IF
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
CDC14 Antibody
(472508) [Unconjugate
MAB4457
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Raji human Burkitt's lymphoma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat CDC14 Monoclonal Antibody (Catalog # MAB4457) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for CDC14 at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, C2C12 mouse myoblast cell line, H4‑II‑E‑C3 rat hepatoma cell line, L6 rat myoblast cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat CDC14 Monoclonal Antibody (Catalog # MAB4457) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for CDC14 at approximately 50-75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
VHR/DUSP3 Antibody
(237020)
MAB1654
Western blot shows lysates of TE-85 human osteogenic sarcoma cell line, TF-1 human erythroleukemic cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.5 µg/mL Mouse Anti-Human/Mouse/Rat VHR Monoclonal Antibody (Catalog # MAB1654) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). For additional reference, Recombinant Human VHR (Catalog # 1654-VH) (2 ng) was included. A specific band for VHR was detected at approximately 24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
DUSP27/DUPD1
Antibody (OTI7E4)
NBP2-03339
Western Blot: DUSP27/DUPD1 Antibody (7E4) [NBP2-03339] - DUSP27/DUPD1 Antibody (7E4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DUSP27 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DUSP27.
Immunohistochemistry-Paraffin: DUSP27/DUPD1 Antibody (7E4) [NBP2-03339] - DUSP27/DUPD1 Antibody (7E4) Staining of paraffin-embedded Human pancreas tissue using anti-DUSP27 mouse monoclonal antibody.
Flow Cytometry: DUSP27/DUPD1 Antibody (7E4) [NBP2-03339] - DUSP27/DUPD1 Antibody (7E4) HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DUSP27 antibody, and then analyzed by flow cytometry.
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
DUSP18 Antibody
NB100-56481
Western Blot: DUSP18 Antibody [NB100-56481] - Analysis of DUSP18 in rat testis lysate in the 1) absence and 2) presence of immunizing peptide and in human testis lysate in the 3) absence and 4) presence of immunizing peptide using this antibody at 0.5 ug/ml.
Species: Hu, Bv, Pm
Applications: WB
PTPMT1 Antibody
NBP3-00055
Western Blot: PTPMT1 Antibody [NBP3-00055] - Anti-PTPMT1 rabbit polyclonal antibody at 1:500 dilution. Lane A: 293T Whole Cell Lysate. Lysates/proteins at 60 ug per lane. Secondary Goat Anti-Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 23 kDa. Observed band size: 18 kDa
Immunohistochemistry-Paraffin: PTPMT1 Antibody [NBP3-00055] - Immunochemical staining of human PTPMT1 in human pancreatic carcinoma with rabbit polyclonal antibody (1:1000, formalin-fixed paraffin embedded sections).
Immunohistochemistry-Paraffin: PTPMT1 Antibody [NBP3-00055] - Immunochemical staining of human PTPMT1 in human liver with rabbit polyclonal antibody (1:1000, formalin-fixed paraffin embedded sections).
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DUSP19 Antibody (NBP1-84041) (0)

There are no publications for DUSP19 Antibody (NBP1-84041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP19 Antibody (NBP1-84041) (0)

There are no reviews for DUSP19 Antibody (NBP1-84041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP19 Antibody (NBP1-84041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional DUSP19 Products

Bioinformatics Tool for DUSP19 Antibody (NBP1-84041)

Discover related pathways, diseases and genes to DUSP19 Antibody (NBP1-84041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DUSP19 Antibody (NBP1-84041)

View related products by pathway.

PTMs for DUSP19 Antibody (NBP1-84041)

Learn more about PTMs related to DUSP19 Antibody (NBP1-84041).

Blogs on DUSP19

There are no specific blogs for DUSP19, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP19 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DUSP19