DUSP19 Antibody

Images

 
Western Blot: DUSP19 Antibody [NBP1-84041] - Analysis in control (vector only transfected HEK293T lysate) and DUSP19 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: DUSP19 Antibody [NBP1-84041] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
Specificity
Specificity of human DUSP19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DUSP19 Protein (NBP1-84041PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP19 Antibody

  • dual specificity phosphatase 19
  • Dual specificity phosphatase TS-DSP1
  • dual specificity protein phosphatase 19
  • DUSP17SAPK pathway-regulating phosphatase 1
  • EC 3.1.3.16
  • EC 3.1.3.48
  • LMWDSP3
  • LMW-DSP3
  • Low molecular weight dual specificity phosphatase 3
  • Protein phosphatase SKRP1
  • SKRP1MGC138210
  • Stress-activated protein kinase pathway-regulating phosphatase 1
  • TS-DSP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67764
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67909
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-89147
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB100-81788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ICC/IF
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB4457
Species: Hu, Mu, Rt
Applications: WB
MAB1654
Species: Hu, Mu, Rt
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-03339
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56481
Species: Hu, Bv, Pm
Applications: WB
NBP3-00055
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DUSP19 Antibody (NBP1-84041) (0)

There are no publications for DUSP19 Antibody (NBP1-84041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP19 Antibody (NBP1-84041) (0)

There are no reviews for DUSP19 Antibody (NBP1-84041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP19 Antibody (NBP1-84041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DUSP19 Products

Bioinformatics Tool for DUSP19 Antibody (NBP1-84041)

Discover related pathways, diseases and genes to DUSP19 Antibody (NBP1-84041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DUSP19 Antibody (NBP1-84041)

View related products by pathway.

PTMs for DUSP19 Antibody (NBP1-84041)

Learn more about PTMs related to DUSP19 Antibody (NBP1-84041).

Blogs on DUSP19

There are no specific blogs for DUSP19, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP19