DUOX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DUOX1 Antibody [NBP1-81301] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DUOX1 Antibody [NBP1-81301] - Staining of human cerebral cortex shows weak cytoplasmic positivity in a subset of neurons.

Immunohistochemistry-Paraffin: DUOX1 Antibody [NBP1-81301] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DUOX1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUOX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DUOX1 Protein (NBP1-81301PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DUOX1 Antibody - BSA Free

• dual oxidase 1
• DUOX
• EC 1.11.1.-
• EC 1.6.3.1
• Large NOX 1
• LNOX1flavoprotein NADPH oxidase
• Long NOX 1
• MGC138840
• NADPH thyroid oxidase 1
• nicotinamide adenine dinucleotide phosphate oxidase
• NOXEF1
• THOX1MGC138841
• Thyroid oxidase 1

Background

The DUOX1 gene encodes a glycoprotein dual oxidase 1 protein with an isoform 1 of 1,551 amino acids long at 177 kDA and an isoform 2 at 1,197 amino acids long at 137 kDA. This protein is called a dual oxidase because it obtains a peroxidase homology domain and a gp91phox domain. DUOX1 generates hydrogen peroxide which is essential for thyroid peroxidase/TPO and lactoperoxidase/LPO, as well as lactoperoxidase-mediated antimicrobial defense. DUOX1 interacts with genes TXNDC11 and TPO and has been investigated for its role in various diseases such as thyroiditis, lung cancer, alcoholism, carcinoma, chronic obstructive pulmonary disease, hypothyroidism, hepatitis, prostatitis, and chronic granulomatous disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for DUOX1 Antibody (NBP1-81301). (Showing 1 - 1 of 1 FAQ).

1. Could you please let me know if you have any information of the following antibody working on mouse tissue? DUOX1 Antibody (NBP1-81301) (100 ul).
   • This antibody has not been tested in mouse, but the immunogen has 89% identity to the mouse protein. If you would like to test this antibody for mouse reactivity you would qualify for our Innovators Reward Program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Bioinformatics

• Gene Symbol: DUOX1