Dtk/TYRO3 Antibody (4F6)

Images

 
Western Blot: Dtk/TYRO3 Antibody (4F6) [H00007301-M05] - Analysis of TYRO3 expression in transfected 293T cell line by TYRO3 monoclonal antibody (M05), clone 4F6. Lane 1: TYRO3 transfected lysatE (96.9 KDa). Lane 2: ...read more
Western Blot: Dtk/TYRO3 Antibody (4F6) [H00007301-M05] - Western blot analysis of TYRO3 over-expressed 293 cell line, cotransfected with TYRO3 Validated Chimera RNAi or non-transfected control. Blot probed with ...read more
ELISA: Dtk/TYRO3 Antibody (4F6) [H00007301-M05] - Detection limit for recombinant GST tagged TYRO3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
4F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dtk/TYRO3 Antibody (4F6) Summary

Immunogen
TYRO3 (AAH49368, 50 a.a. - 150 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
Specificity
TYRO3 - TYRO3 protein tyrosine kinase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TYRO3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dtk/TYRO3 Antibody (4F6)

  • Brt
  • BYK
  • Dtk
  • EC 2.7.10
  • EC 2.7.10.1
  • FLJ16467
  • Rse
  • Sky
  • Tif
  • TYRO3 protein tyrosine kinase
  • Tyro3
  • Tyrosine-protein kinase byk
  • Tyrosine-protein kinase DTK
  • tyrosine-protein kinase receptor TYRO3
  • Tyrosine-protein kinase RSE
  • Tyrosine-protein kinase SKY

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
AF885
Species: Hu
Applications: WB, IHC
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Dtk/TYRO3 Antibody (H00007301-M05) (0)

There are no publications for Dtk/TYRO3 Antibody (H00007301-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dtk/TYRO3 Antibody (H00007301-M05) (0)

There are no reviews for Dtk/TYRO3 Antibody (H00007301-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dtk/TYRO3 Antibody (H00007301-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dtk/TYRO3 Products

Bioinformatics Tool for Dtk/TYRO3 Antibody (H00007301-M05)

Discover related pathways, diseases and genes to Dtk/TYRO3 Antibody (H00007301-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dtk/TYRO3 Antibody (H00007301-M05)

Discover more about diseases related to Dtk/TYRO3 Antibody (H00007301-M05).
 

Pathways for Dtk/TYRO3 Antibody (H00007301-M05)

View related products by pathway.

PTMs for Dtk/TYRO3 Antibody (H00007301-M05)

Learn more about PTMs related to Dtk/TYRO3 Antibody (H00007301-M05).
 

Research Areas for Dtk/TYRO3 Antibody (H00007301-M05)

Find related products by research area.

Blogs on Dtk/TYRO3

There are no specific blogs for Dtk/TYRO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dtk/TYRO3 Antibody (4F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TYRO3
Entrez
OMIM
Uniprot