Recombinant Human DSCAM Protein

Images

 

Product Details

Summary
Product Discontinued
View other related DSCAM Peptides and Proteins

Order Details


    • Catalog Number
      H00001826-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human DSCAM Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-88 of Human DSCAM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRF

Protein/Peptide Type
Partial Recombinant Protein
Gene
DSCAM

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DSCAM Protein

  • CHD2-42
  • CHD2-52
  • Down syndrome cell adhesion molecule
  • DSCAM
  • human CHD2-52 down syndrome cell adhesion molecule, 10CHD2

Background

DSCAM - Down syndrome cell adhesion molecule

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3315
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF844
Species: Mu
Applications: WB, Block
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
NB100-60411
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-2307
Species: Hu
Applications: WB
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for DSCAM Partial Recombinant Protein (H00001826-Q01) (0)

There are no publications for DSCAM Partial Recombinant Protein (H00001826-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSCAM Partial Recombinant Protein (H00001826-Q01) (0)

There are no reviews for DSCAM Partial Recombinant Protein (H00001826-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DSCAM Partial Recombinant Protein (H00001826-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DSCAM Products

Bioinformatics Tool for DSCAM Partial Recombinant Protein (H00001826-Q01)

Discover related pathways, diseases and genes to DSCAM Partial Recombinant Protein (H00001826-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSCAM Partial Recombinant Protein (H00001826-Q01)

Discover more about diseases related to DSCAM Partial Recombinant Protein (H00001826-Q01).
 

Pathways for DSCAM Partial Recombinant Protein (H00001826-Q01)

View related products by pathway.

PTMs for DSCAM Partial Recombinant Protein (H00001826-Q01)

Learn more about PTMs related to DSCAM Partial Recombinant Protein (H00001826-Q01).

Blogs on DSCAM

There are no specific blogs for DSCAM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DSCAM Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCAM
Entrez