DRIL1 Antibody (1A11) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related DRIL1 Primary Antibodies

Order Details


    • Catalog Number
      H00001820-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DRIL1 Antibody (1A11) [PerCP] Summary

Immunogen
ARID3A (NP_005215 317 a.a. - 416 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Specificity
ARID3A - AT rich interactive domain 3A (BRIGHT- like)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARID3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DRIL1 Antibody (1A11) [PerCP]

  • ARID domain-containing 3A
  • ARID domain-containing protein 3A
  • AT rich interactive domain 3A (BRIGHT- like) protein
  • AT rich interactive domain 3A (BRIGHT- like)
  • AT rich interactive domain 3A (BRIGHT-like)
  • AT-rich interactive domain-containing protein 3A
  • B-cell regulator of IgH transcription
  • BRIGHT
  • dead ringer-like 1
  • Dead ringer-like protein 1
  • DRIL1dead ringer-like 1 (Drosophila)
  • DRIL3
  • DRX
  • E2F-binding protein 1
  • E2FBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33596
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF4715
Species: Mu
Applications: WB
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
AF6897
Species: Hu, Mu
Applications: WB, IHC

Publications for DRIL1 Antibody (H00001820-M01PCP) (0)

There are no publications for DRIL1 Antibody (H00001820-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRIL1 Antibody (H00001820-M01PCP) (0)

There are no reviews for DRIL1 Antibody (H00001820-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DRIL1 Antibody (H00001820-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRIL1 Products

Bioinformatics Tool for DRIL1 Antibody (H00001820-M01PCP)

Discover related pathways, diseases and genes to DRIL1 Antibody (H00001820-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRIL1 Antibody (H00001820-M01PCP)

Discover more about diseases related to DRIL1 Antibody (H00001820-M01PCP).
 

Pathways for DRIL1 Antibody (H00001820-M01PCP)

View related products by pathway.

PTMs for DRIL1 Antibody (H00001820-M01PCP)

Learn more about PTMs related to DRIL1 Antibody (H00001820-M01PCP).

Blogs on DRIL1

There are no specific blogs for DRIL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRIL1 Antibody (1A11) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID3A