Recombinant Human DR6/TNFRSF21 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related DR6/TNFRSF21 Peptides and Proteins

Order Details


    • Catalog Number
      H00027242-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human DR6/TNFRSF21 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-124 of Human TNFRSF21 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQFNFELSFKYVLYSSYSWLKLDHTIADCMVFTWTPCRMLDYLYSSYANMLWAGEMKSSSHQDLLFKWLDNWATKELELHLLGFELFWNTLLHFGKSKSSASGALSIENLPSFALKDVLFFIYT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TNFRSF21

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DR6/TNFRSF21 Protein

  • BM-018
  • CD358 antigen
  • CD358
  • Death receptor 6
  • DR6
  • DR6TNFR-related death receptor 6
  • MGC31965
  • TNFRSF21
  • tumor necrosis factor receptor superfamily member 21
  • tumor necrosis factor receptor superfamily, member 21

Background

TNFRSF21( AAH05192, 1 a.a. - 125 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00027242-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DR6/TNFRSF21 Recombinant Protein (H00027242-P01) (0)

There are no publications for DR6/TNFRSF21 Recombinant Protein (H00027242-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DR6/TNFRSF21 Recombinant Protein (H00027242-P01) (0)

There are no reviews for DR6/TNFRSF21 Recombinant Protein (H00027242-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DR6/TNFRSF21 Recombinant Protein (H00027242-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DR6/TNFRSF21 Products

Bioinformatics Tool for DR6/TNFRSF21 Recombinant Protein (H00027242-P01)

Discover related pathways, diseases and genes to DR6/TNFRSF21 Recombinant Protein (H00027242-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DR6/TNFRSF21 Recombinant Protein (H00027242-P01)

Discover more about diseases related to DR6/TNFRSF21 Recombinant Protein (H00027242-P01).
 

Pathways for DR6/TNFRSF21 Recombinant Protein (H00027242-P01)

View related products by pathway.

PTMs for DR6/TNFRSF21 Recombinant Protein (H00027242-P01)

Learn more about PTMs related to DR6/TNFRSF21 Recombinant Protein (H00027242-P01).
 

Research Areas for DR6/TNFRSF21 Recombinant Protein (H00027242-P01)

Find related products by research area.

Blogs on DR6/TNFRSF21

There are no specific blogs for DR6/TNFRSF21, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DR6/TNFRSF21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF21
Entrez