DR6/TNFRSF21 Antibody


Western Blot: DR6 Antibody [NBP1-62731] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DR6/TNFRSF21 Antibody Summary

Synthetic peptides corresponding to TNFRSF21(tumor necrosis factor receptor superfamily, member 21) The peptide sequence was selected form the N terminal of TNFRSF21. Peptide sequence TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against TNFRSF21 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DR6/TNFRSF21 Antibody

  • BM-018
  • CD358 antigen
  • CD358
  • Death receptor 6
  • DR6
  • DR6TNFR-related death receptor 6
  • MGC31965
  • TNFRSF21
  • tumor necrosis factor receptor superfamily member 21
  • tumor necrosis factor receptor superfamily, member 21


TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB

Publications for DR6/TNFRSF21 Antibody (NBP1-62731) (0)

There are no publications for DR6/TNFRSF21 Antibody (NBP1-62731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DR6/TNFRSF21 Antibody (NBP1-62731) (0)

There are no reviews for DR6/TNFRSF21 Antibody (NBP1-62731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DR6/TNFRSF21 Antibody (NBP1-62731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DR6/TNFRSF21 Antibody (NBP1-62731)

Discover related pathways, diseases and genes to DR6/TNFRSF21 Antibody (NBP1-62731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DR6/TNFRSF21 Antibody (NBP1-62731)

Discover more about diseases related to DR6/TNFRSF21 Antibody (NBP1-62731).

Pathways for DR6/TNFRSF21 Antibody (NBP1-62731)

View related products by pathway.

PTMs for DR6/TNFRSF21 Antibody (NBP1-62731)

Learn more about PTMs related to DR6/TNFRSF21 Antibody (NBP1-62731).

Research Areas for DR6/TNFRSF21 Antibody (NBP1-62731)

Find related products by research area.

Blogs on DR6/TNFRSF21

There are no specific blogs for DR6/TNFRSF21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DR6/TNFRSF21 Antibody and receive a gift card or discount.


Gene Symbol TNFRSF21