DPPIV/CD26 Antibody

Images

 
Immunocytochemistry: DPPIV/CD26 Antibody [NB120-17538] - CD26 Antibody [NB120-17538] - ICC: Immunocytochemistry staining of endogenous DPP IV in normal rat kidney (NRK) cells. Anti-DPP IV IgY dilution: 1:200; Donkey ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Chicken
Conjugate
Unconjugated
Concentration
1.0 mg/ml

Order Details

DPPIV/CD26 Antibody Summary

Immunogen
Synthetic peptide: YAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAA, corresponding to amino acids 547-610 of Human CD26.
Localization
Type II membrane protein. Also exists in a soluble form.
Specificity
CD26
Clonality
Polyclonal
Host
Chicken
Gene
DPP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
Positive Control
DPPIV/CD26 Lysate (NBL1-09997)

Reactivity Notes

Expected to cross-react with Cow (96% identity with immunogen), Cat (98% identity with immunogen), Chicken (89% identity with immunogen), Dog (93% identity with immunogen) and Pig (93% identity with immunogen) due to sequence homology. Not yet tested in other species.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
No Preservative
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for DPPIV/CD26 Antibody

  • ADABP
  • ADCP-2
  • ADCP2DPP IV
  • Adenosine deaminase complexing protein 2TP103
  • CD26 antigen
  • CD26
  • CD26T-cell activation antigen CD26
  • dipeptidyl peptidase 4
  • Dipeptidyl peptidase IV
  • dipeptidylpeptidase 4
  • dipeptidyl-peptidase 4
  • dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2)
  • DPP4
  • DPPIV
  • EC 3.4.14.5

Background

CD26 [also known as dipeptidyl peptidase IV (DPP IV), adenosine deaminase (ADA) binding protein] is an atypical serine protease belonging to the prolyl oligopeptidase family. It is expressed on lymphocyte cells and is upregulated during T cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8864
Species: Hu
Applications: IHC
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84986
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for DPPIV/CD26 Antibody (NB120-17538) (0)

There are no publications for DPPIV/CD26 Antibody (NB120-17538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPPIV/CD26 Antibody (NB120-17538) (0)

There are no reviews for DPPIV/CD26 Antibody (NB120-17538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPPIV/CD26 Antibody (NB120-17538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional DPPIV/CD26 Products

Bioinformatics Tool for DPPIV/CD26 Antibody (NB120-17538)

Discover related pathways, diseases and genes to DPPIV/CD26 Antibody (NB120-17538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPPIV/CD26 Antibody (NB120-17538)

Discover more about diseases related to DPPIV/CD26 Antibody (NB120-17538).
 

Pathways for DPPIV/CD26 Antibody (NB120-17538)

View related products by pathway.

PTMs for DPPIV/CD26 Antibody (NB120-17538)

Learn more about PTMs related to DPPIV/CD26 Antibody (NB120-17538).
 

Research Areas for DPPIV/CD26 Antibody (NB120-17538)

Find related products by research area.

Blogs on DPPIV/CD26

There are no specific blogs for DPPIV/CD26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPPIV/CD26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP4
Entrez