DPPIV/CD26 Antibody (1C5)

Images

 
ELISA: DPPIV/CD26 Antibody (1C5) [H00001803-M03] - Detection limit for recombinant GST tagged DPP4 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related DPPIV/CD26 Primary Antibodies

Order Details


    • Catalog Number
      H00001803-M03
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DPPIV/CD26 Antibody (1C5) Summary

Immunogen
DPP4 (AAH65265 352 a.a. - 451 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP
Specificity
DPP4 (1C5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DPP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DPPIV/CD26 Antibody (1C5)

  • ADABP
  • ADCP-2
  • ADCP2DPP IV
  • Adenosine deaminase complexing protein 2TP103
  • CD26 antigen
  • CD26
  • CD26T-cell activation antigen CD26
  • dipeptidyl peptidase 4
  • Dipeptidyl peptidase IV
  • dipeptidylpeptidase 4
  • dipeptidyl-peptidase 4
  • dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2)
  • DPP4
  • DPPIV
  • EC 3.4.14.5

Background

The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8864
Species: Hu
Applications: IHC
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84986
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for DPPIV/CD26 Antibody (H00001803-M03) (0)

There are no publications for DPPIV/CD26 Antibody (H00001803-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPPIV/CD26 Antibody (H00001803-M03) (0)

There are no reviews for DPPIV/CD26 Antibody (H00001803-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DPPIV/CD26 Antibody (H00001803-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPPIV/CD26 Products

Bioinformatics Tool for DPPIV/CD26 Antibody (H00001803-M03)

Discover related pathways, diseases and genes to DPPIV/CD26 Antibody (H00001803-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPPIV/CD26 Antibody (H00001803-M03)

Discover more about diseases related to DPPIV/CD26 Antibody (H00001803-M03).
 

Pathways for DPPIV/CD26 Antibody (H00001803-M03)

View related products by pathway.

PTMs for DPPIV/CD26 Antibody (H00001803-M03)

Learn more about PTMs related to DPPIV/CD26 Antibody (H00001803-M03).
 

Research Areas for DPPIV/CD26 Antibody (H00001803-M03)

Find related products by research area.

Blogs on DPPIV/CD26

There are no specific blogs for DPPIV/CD26, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPPIV/CD26 Antibody (1C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP4
Entrez
OMIM
Uniprot