DPP10 Antibody

Images

 
Western Blot: DPP10 Antibody [NBP1-59589] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related DPP10 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59589
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DPP10 Antibody Summary

Immunogen
Synthetic peptides corresponding to DPP10(dipeptidyl-peptidase 10) The peptide sequence was selected from the middle region of DPP10. Peptide sequence VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE.
Clonality
Polyclonal
Host
Rabbit
Gene
DPP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against DPP10 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPP10 Antibody

  • dipeptidyl peptidase 10
  • Dipeptidyl peptidase IV-related protein 3
  • dipeptidyl peptidase like protein 2
  • Dipeptidyl peptidase X
  • Dipeptidyl peptidase-like protein 2
  • dipeptidyl-peptidase 10 (non-functional)
  • dipeptidyl-peptidase 10
  • DPL2
  • DPP X
  • DPP10
  • DPPY
  • DPRP3
  • DPRP-3
  • DPRP3dipeptidylpeptidase 10
  • inactive dipeptidyl peptidase 10
  • KIAA1492

Background

DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47481
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-88684
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5565
Species: Hu
Applications: IP, ICFlow
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87708
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82864
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01521
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF3715
Species: Hu
Applications: WB, IHC, IP
NBP1-81336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP1-90509
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91612
Species: Mu
Applications: WB
NBP1-59589
Species: Hu
Applications: WB

Publications for DPP10 Antibody (NBP1-59589) (0)

There are no publications for DPP10 Antibody (NBP1-59589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP10 Antibody (NBP1-59589) (0)

There are no reviews for DPP10 Antibody (NBP1-59589). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPP10 Antibody (NBP1-59589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPP10 Antibody Products

Related Products by Gene

Bioinformatics Tool for DPP10 Antibody (NBP1-59589)

Discover related pathways, diseases and genes to DPP10 Antibody (NBP1-59589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPP10 Antibody (NBP1-59589)

Discover more about diseases related to DPP10 Antibody (NBP1-59589).
 

Pathways for DPP10 Antibody (NBP1-59589)

View related products by pathway.

PTMs for DPP10 Antibody (NBP1-59589)

Learn more about PTMs related to DPP10 Antibody (NBP1-59589).

Blogs on DPP10

There are no specific blogs for DPP10, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol DPP10
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59589 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.