DPP10 Antibody


Western Blot: DPP10 Antibody [NBP1-59589] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related DPP10 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DPP10 Antibody Summary

Synthetic peptides corresponding to DPP10(dipeptidyl-peptidase 10) The peptide sequence was selected from the middle region of DPP10. Peptide sequence VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against DPP10 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPP10 Antibody

  • dipeptidyl peptidase 10
  • Dipeptidyl peptidase IV-related protein 3
  • dipeptidyl peptidase like protein 2
  • Dipeptidyl peptidase X
  • Dipeptidyl peptidase-like protein 2
  • dipeptidyl-peptidase 10 (non-functional)
  • dipeptidyl-peptidase 10
  • DPL2
  • DPP X
  • DPP10
  • DPPY
  • DPRP3
  • DPRP-3
  • DPRP3dipeptidylpeptidase 10
  • inactive dipeptidyl peptidase 10
  • KIAA1492


DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB

Publications for DPP10 Antibody (NBP1-59589) (0)

There are no publications for DPP10 Antibody (NBP1-59589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP10 Antibody (NBP1-59589) (0)

There are no reviews for DPP10 Antibody (NBP1-59589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPP10 Antibody (NBP1-59589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DPP10 Products

Bioinformatics Tool for DPP10 Antibody (NBP1-59589)

Discover related pathways, diseases and genes to DPP10 Antibody (NBP1-59589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPP10 Antibody (NBP1-59589)

Discover more about diseases related to DPP10 Antibody (NBP1-59589).

Pathways for DPP10 Antibody (NBP1-59589)

View related products by pathway.

PTMs for DPP10 Antibody (NBP1-59589)

Learn more about PTMs related to DPP10 Antibody (NBP1-59589).

Blogs on DPP10

There are no specific blogs for DPP10, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DPP10 Antibody and receive a gift card or discount.


Gene Symbol DPP10